FC920412

Overview
NameFC920412
Unique NameFC920412
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length731
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14138 contig Ccv1_Contig14138:1..731. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920412 vs. ExPASy Swiss-Prot
Match: DNJ10_ARATH (Chaperone protein dnaJ 10 OS=Arabidopsis thaliana GN=ATJ10 PE=2 SV=2)

HSP 1 Score: 299.671 bits (766), Expect = 1.082e-80
Identity = 152/185 (82.16%), Postives = 169/185 (91.35%), Query Frame = 3
Query:  177 MVKETEYYDVLGVSPTASEAEIKKAYYIKARKVHPDKNPNDPLAAQNFQVLGEAYQVLSDPAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASVASLDIFTEGEEFDAKKLQDKMKVVQKEREEKLADILRGRLNQYVQGKQEDFINYAEAEVSRLSNAAYGGDMXNTIGY 731
            MVKETEYYDVLGVSPTA+E+EIKKAYYIKAR+VHPDKNPNDP AA NFQVLGEAYQVLSD  QRQAYDA GKSGIST+AIIDPAAIFAMLFGSELFE YIGQLAMAS+ASLDIFTEG++FD KK+Q+K+++VQKERE+KLA IL+ RLN+YV  K E FI+ AEAEV+RLSNAAYG DM NTIGY
Sbjct:    1 MVKETEYYDVLGVSPTATESEIKKAYYIKARQVHPDKNPNDPQAAHNFQVLGEAYQVLSDSGQRQAYDACGKSGISTDAIIDPAAIFAMLFGSELFEGYIGQLAMASMASLDIFTEGDQFDTKKIQEKLRIVQKEREDKLAQILKDRLNEYVINKDE-FISNAEAEVARLSNAAYGVDMLNTIGY 184          
BLAST of FC920412 vs. ExPASy Swiss-Prot
Match: CAJ1_YEAST (Protein CAJ1 OS=Saccharomyces cerevisiae GN=CAJ1 PE=1 SV=1)

HSP 1 Score: 117.087 bits (292), Expect = 9.951e-26
Identity = 64/188 (34.04%), Postives = 100/188 (53.19%), Query Frame = 3
Query:  177 MVKETEYYDVLGVSPTASEAEIKKAYYIKARKVHPDKNPNDPLAAQNFQVLGEAYQVLSDPAQRQAYDAYGK-SGISTEAIIDPAAIFAMLFGSELFEDYIGQLAM----------------ASVASLDIFTEGEEFDAKKLQDKMKVVQKEREEKLADILRGRLNQYVQGKQEDFINYAEAEVSRLS 689
            MVKETEYYD+LG+ P A+  EIKKAY  KA + HPDK+P+DP A   FQ +GEAYQVLSDP  R  YD +GK   +  +   D +  F  +FG + F+D+IG+ ++                   A+ +     E  D   ++      +  +++KL+   R +L +  + ++ED +   +    +L+
Sbjct:    1 MVKETEYYDILGIKPEATPTEIKKAYRRKAMETHPDKHPDDPDAQAKFQAVGEAYQVLSDPGLRSKYDQFGKEDAVPQQGFEDASEYFTAIFGGDGFKDWIGEFSLFKELNEATEMFGKEDEEGTAATETEKADESTDGGMVKHDTNKAESLKKDKLSKEQREKLMEMEKKRREDMMKQVDELAEKLN 188          
BLAST of FC920412 vs. ExPASy Swiss-Prot
Match: DJP1_YEAST (DnaJ-like protein 1 OS=Saccharomyces cerevisiae GN=DJP1 PE=1 SV=1)

HSP 1 Score: 115.931 bits (289), Expect = 2.217e-25
Identity = 67/143 (46.85%), Postives = 84/143 (58.74%), Query Frame = 3
Query:  177 MVKETEYYDVLGVSPTASEAEIKKAYYIKARKVHPDKNPNDPLAAQNFQVLGEAYQVLSDPAQRQAYDAYG-KSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASVASLDIFTEGEEFDAKKLQDKMKVVQKEREEKLAD 602
            MV +TEYYD+LGVS TAS  EIKKAY  K+ + HPDKNPNDP A + FQ + EAYQVL D   R  YD YG K  I      D A  F+++FG + F  YIG+L +     L    + EE +A+   +K K   +  EE  AD
Sbjct:    1 MVVDTEYYDLLGVSTTASSIEIKKAYRKKSIQEHPDKNPNDPTATERFQAISEAYQVLGDDDLRAKYDKYGRKEAIPQGGFEDAAEQFSVIFGGDAFASYIGELML-----LKNLQKTEELNAEDEAEKEKENVETMEESPAD 138          
BLAST of FC920412 vs. ExPASy Swiss-Prot
Match: YHXB_SCHPO (Uncharacterized J domain-containing protein C3E7.11c OS=Schizosaccharomyces pombe GN=SPBC3E7.11c PE=2 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 5.289e-19
Identity = 64/201 (31.84%), Postives = 99/201 (49.25%), Query Frame = 3
Query:  180 VKETEYYDVLGVSPTASEAEIKKAYYIKARKVHPDKNPNDPLAA-QNFQVLGEAYQVLSDPAQRQAYDAYGKSGISTEAIIDPA-AIFAMLFGSELFEDYIGQLAMASVASLDIFTEGEEFDAKKLQDKMKVVQKEREEKLADILRGRLNQYVQGKQEDFINYAEAEVS----------------RLSNAAYGGDMXNTIG 728
            V + +YYD+L +S  A    IKK+Y   A   HPDKN  +P AA + FQ L EAYQVLSDP  R+ YD  GK G   +A  + A   F  LFG + F DY+G+L +       I  E E    +  ++  K +Q+E  ++   +L+ R++   +   +    + E ++S                 L + ++G +M + IG
Sbjct:    5 VVDRDYYDILNISVDADGDTIKKSYRRLAILYHPDKNRENPEAAREKFQKLAEAYQVLSDPKLREKYDKLGKVGAVPDAGFEDAFEFFKNLFGGDSFRDYVGELNLLKELCKMINEEPELKAIEDTEESKKQLQREESKEADRLLQERIDVLCKNLLDKLSIWTETDMSDRVTDAFKQKMQFEAELLKDESFGNEMLHAIG 205          
BLAST of FC920412 vs. ExPASy Swiss-Prot
Match: YAY1_SCHPO (Uncharacterized J domain-containing protein C4H3.01 OS=Schizosaccharomyces pombe GN=SPAC4H3.01 PE=1 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 9.021e-19
Identity = 52/137 (37.96%), Postives = 79/137 (57.66%), Query Frame = 3
Query:  186 ETEYYDVLGVSPTASEAEIKKAYYIKARKVHPDKNPNDPL-AAQNFQVLGEAYQVLSDPAQRQAYDAYGK-SGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASVASLDIFTEGEE-FDAKKLQDKMKVVQKERE 587
            +TEYYD+LG+S  A+  +IKKAY   A K HPDKNP+DP  A++ FQ + EAYQVL D   R  YD +GK   +  +   D    F  LFG   F +++G+L+       ++F E +   +  ++ DK +++ +  E
Sbjct:    6 DTEYYDLLGISTDATAVDIKKAYRKLAVKYHPDKNPDDPQGASEKFQKISEAYQVLGDEKLRSQYDQFGKEKAVPEQGFTDAYDFFTNLFGGAPFREWVGELSFVK----EMFREEDSAVEQGQMNDKQQLLLESSE 138          
BLAST of FC920412 vs. ExPASy Swiss-Prot
Match: DNJA4_HUMAN (DnaJ homolog subfamily A member 4 OS=Homo sapiens GN=DNAJA4 PE=1 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 9.974e-18
Identity = 47/97 (48.45%), Postives = 62/97 (63.92%), Query Frame = 3
Query:  177 MVKETEYYDVLGVSPTASEAEIKKAYYIKARKVHPDKNPNDPLAAQNFQVLGEAYQVLSDPAQRQAYDAYG-----KSGISTEAIIDPAAIFAMLFG 452
            MVKET+YYD+LGV P+AS  EIKKAY   A K HPDKNP++    + F+++ +AY+VLSDP +R  YD  G     + G  + +   P  IF M FG
Sbjct:    1 MVKETQYYDILGVKPSASPEEIKKAYRKLALKYHPDKNPDE---GEKFKLISQAYEVLSDPKKRDVYDQGGEQAIKEGGSGSPSFSSPMDIFDMFFG 94          
BLAST of FC920412 vs. ExPASy Swiss-Prot
Match: DNJA3_HUMAN (DnaJ homolog subfamily A member 3, mitochondrial OS=Homo sapiens GN=DNAJA3 PE=1 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 9.974e-18
Identity = 49/116 (42.24%), Postives = 65/116 (56.03%), Query Frame = 3
Query:  171 SVMVKETEYYDVLGVSPTASEAEIKKAYYIKARKVHPDKNPNDPLAAQNFQVLGEAYQVLSDPAQRQAYDAYGKSGISTEA------------IIDPAAIFAMLFG---SELFEDY 473
            S  + + +YY +LGV   AS+ EIKKAYY  A+K HPD N +DP A + F  L EAY+VLSD  +R+ YDAYG +G    A             +DP  +F  +FG   S  F D+
Sbjct:   86 SAPLAKEDYYQILGVPRNASQKEIKKAYYQLAKKYHPDTNKDDPKAKEKFSQLAEAYEVLSDEVKRKQYDAYGSAGFDPGASGSQHSYWKGGPTVDPEELFRKIFGEFSSSSFGDF 201          
BLAST of FC920412 vs. ExPASy Swiss-Prot
Match: DNJA4_MOUSE (DnaJ homolog subfamily A member 4 OS=Mus musculus GN=Dnaja4 PE=2 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 1.303e-17
Identity = 47/97 (48.45%), Postives = 62/97 (63.92%), Query Frame = 3
Query:  177 MVKETEYYDVLGVSPTASEAEIKKAYYIKARKVHPDKNPNDPLAAQNFQVLGEAYQVLSDPAQRQAYDAYG-----KSGISTEAIIDPAAIFAMLFG 452
            MVKET+YYD+LGV P+AS  EIKKAY   A K HPDKNP++    + F+++ +AY+VLSDP +R  YD  G     + G  + +   P  IF M FG
Sbjct:    1 MVKETQYYDILGVKPSASPEEIKKAYRKLALKYHPDKNPDE---GEKFKLISQAYEVLSDPKKRDIYDQGGEQAIKEGGSGSPSFSSPMDIFDMFFG 94          
BLAST of FC920412 vs. ExPASy Swiss-Prot
Match: DNAJ_SALRD (Chaperone protein dnaJ OS=Salinibacter ruber (strain DSM 13855) GN=dnaJ PE=3 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 1.303e-17
Identity = 41/74 (55.41%), Postives = 53/74 (71.62%), Query Frame = 3
Query:  192 EYYDVLGVSPTASEAEIKKAYYIKARKVHPDKNPNDPLAAQNFQVLGEAYQVLSDPAQRQAYDAYGKSGISTEA 413
            +YYD+LGV   AS+ EIKKAY  KA + HPD+NP+DP A Q F+   EAY+VLSDP +RQ YD +G  G+ + A
Sbjct:    4 DYYDILGVDEDASDKEIKKAYRKKAMEYHPDRNPDDPEAEQKFKEASEAYEVLSDPEKRQRYDQFGHDGVDSGA 77          
BLAST of FC920412 vs. ExPASy Swiss-Prot
Match: MAS5_YEAST (Mitochondrial protein import protein MAS5 OS=Saccharomyces cerevisiae GN=YDJ1 PE=1 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 3.790e-17
Identity = 45/101 (44.55%), Postives = 63/101 (62.38%), Query Frame = 3
Query:  177 MVKETEYYDVLGVSPTASEAEIKKAYYIKARKVHPDKNPNDPLAAQNFQVLGEAYQVLSDPAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIG 479
            MVKET++YD+LGV  TA++ EIKKAY   A K HPDKNP++  AA+ F+    AY++LSDP +R  YD +G+ G+S              FG ++F  + G
Sbjct:    1 MVKETKFYDILGVPVTATDVEIKKAYRKCALKYHPDKNPSEE-AAEKFKEASAAYEILSDPEKRDIYDQFGEDGLSGAGGAGGFPGGGFGFGDDIFSQFFG 100          
The following BLAST results are available for this feature:
BLAST of FC920412 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
DNJ10_ARATH1.082e-8082.16Chaperone protein dnaJ 10 OS=Arabidopsis thaliana ... [more]
CAJ1_YEAST9.951e-2634.04Protein CAJ1 OS=Saccharomyces cerevisiae GN=CAJ1 P... [more]
DJP1_YEAST2.217e-2546.85DnaJ-like protein 1 OS=Saccharomyces cerevisiae GN... [more]
YHXB_SCHPO5.289e-1931.84Uncharacterized J domain-containing protein C3E7.1... [more]
YAY1_SCHPO9.021e-1937.96Uncharacterized J domain-containing protein C4H3.0... [more]
DNJA4_HUMAN9.974e-1848.45DnaJ homolog subfamily A member 4 OS=Homo sapiens ... [more]
DNJA3_HUMAN9.974e-1842.24DnaJ homolog subfamily A member 3, mitochondrial O... [more]
DNJA4_MOUSE1.303e-1748.45DnaJ homolog subfamily A member 4 OS=Mus musculus ... [more]
DNAJ_SALRD1.303e-1755.41Chaperone protein dnaJ OS=Salinibacter ruber (stra... [more]
MAS5_YEAST3.790e-1744.55Mitochondrial protein import protein MAS5 OS=Sacch... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32008A07EF RVDevelop1 Citrus clementina cDNA clone C32008A07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920412 ID=FC920412|Name=FC920412|organism=Citrus clementina|type=EST|length=731bp
GGAAGGAATCAGAGGTCAGCGCGCGGGAGAGTAAATCTGCTTTCATCCTT
TTTGTATGCTCTATTCTATCTGTTATCTTTCTGAATCTGCTTCGTAACTA
ATCAGTTTGATTTAGATTGTAAATCGAAGAAAGCTAAGCTAGACTAGTAG
TAATTTTCGGGTCTTGAGAATCAGTGATGGTTAAGGAGACGGAATATTAC
GACGTCCTAGGCGTCAGCCCAACGGCTTCGGAGGCCGAGATCAAGAAAGC
TTACTACATCAAGGCACGTAAGGTTCACCCTGATAAAAACCCAAATGATC
CTCTTGCTGCTCAAAATTTTCAGGTTTTGGGAGAGGCTTACCAGGTATTG
AGTGATCCAGCCCAACGGCAAGCATATGATGCTTATGGGAAATCAGGAAT
CTCAACTGAAGCAATTATTGATCCTGCAGCAATCTTCGCGATGCTTTTTG
GAAGTGAGCTTTTTGAGGATTATATAGGTCAGCTTGCCATGGCTTCAGTG
GCTTCTCTAGACATTTTCACTGAAGGGGAAGAGTTTGATGCTAAAAAGTT
GCAAGACAAAATGAAGGTTGTTCAGAAGGAAAGGGAGGAAAAACTTGCAG
ATATACTAAGAGGTCGACTCAACCAATATGTACAAGGGAAACAAGAGGAT
TTCATTAATTATGCTGAAGCTGAAGTTTCAAGGCTGTCTAATGCTGCGTA
TGGTGGTGATATGNTGAATACAATTGGCTAT
back to top