FC920413

Overview
NameFC920413
Unique NameFC920413
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length726
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig3887 contig Ccv1_Contig3887:1..690. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920413 vs. ExPASy Swiss-Prot
Match: PLZ12_LUPPO (Protein PPLZ12 OS=Lupinus polyphyllus GN=PPLZ12 PE=2 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 1.622e-12
Identity = 39/84 (46.43%), Postives = 49/84 (58.33%), Query Frame = 2
Query:  443 LDLDATFEQKNDIAKAVEEELEKAMSHYGYEIVQTLIVDIEPDEHVKRAMNXXXXXXXXXXXXXXXXXXXXXLQIKRAEGEAES 694
            ++LD  FEQK ++AK+V EELEK M  YGY I   L+VDI PD+ V+RAMN                     LQ+KRAE EAE+
Sbjct:    1 MNLDDLFEQKGEVAKSVLEELEKVMGEYGYNIEHILMVDIIPDDSVRRAMNEINAAQRMQLASLYKGEAEKILQVKRAEAEAEA 84          
The following BLAST results are available for this feature:
BLAST of FC920413 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
PLZ12_LUPPO1.622e-1246.43Protein PPLZ12 OS=Lupinus polyphyllus GN=PPLZ12 PE... [more]
back to top
Properties
Property NameValue
Genbank descriptionC32008A10EF RVDevelop1 Citrus clementina cDNA clone C32008A10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920413 ID=FC920413|Name=FC920413|organism=Citrus clementina|type=EST|length=726bp
GACTCTTTCATAATTCATATATTCTGTGTATTTTAAAATTAATCTCTCAT
CTTTCCCTCGTCACTTTCGCAAAATTTGTTTAGTTAAAAGCTTTAGGTAT
AATCAGAAAATGGGACAAGCTTTAGGTTGTATTCAGGTGGATCAGTCAAC
TGTGGCCATCAGGGAAACCTTTGGGAATTTTGATGAGGTGCTTGAACCTG
GCTGTCACTGTTTGCCTTGGTGTTTGGGGAGCCAAGTAGCAGGTCAACTC
TCATTACGTGTTCAGCAGTTGGATGTTCGATGTGAAACAAAAACCAAGGA
CAATGTGTTTGTTAATGTGGTTGCTTCCGTTCAATACCGAGCCTTGGCAG
AGAAGGCTTCAGATGCCTTTTATAAGCTCAGCAATACTAGATCGCAGATC
CAAGCGTATGTCTTTGATGTTATTAGGGCAAGTGTACCAAAGCTGGACCT
GGATGCAACCTTTGAGCAGAAGAACGACATAGCCAAAGCTGTGGAAGAGG
AACTCGAAAAGGCCATGTCTCATTATGGTTATGAGATAGTTCAGACTCTC
ATCGTAGATATTGAACCAGATGAACATGTGAAGAGAGCAATGAATGAGAT
CAATGCAGCGGCCAGATTGAGGCTGGCTGCAAATGAGAAAGCGGAAGCAG
AGAAAATATTGCAGATCAAGCGTGCTGAAGGAGAAGCAGAATCAAGTATT
TGGCAGGCCTTGGTATGCACGTCAGC
back to top