FC920414

Overview
NameFC920414
Unique NameFC920414
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length738
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14139 contig Ccv1_Contig14139:1..740. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920414 vs. ExPASy Swiss-Prot
Match: UGDH_SOYBN (UDP-glucose 6-dehydrogenase OS=Glycine max PE=2 SV=1)

HSP 1 Score: 385.571 bits (989), Expect = 7.341e-110
Identity = 192/202 (95.05%), Postives = 197/202 (97.52%), Query Frame = 3
Query:   75 MVKICCIGAGYVGGPTMAVIALKCPSIEVAVVDISVSRINAWNSDQLPIYEPGLDGVVKQCRGKNLFFSTDVEKHVSEADIVFVSVNTPTKTQGLGAGKAADLTYWESAARVIADVSKSDKIVVEKSTVPVKTAEAIEKILTHNSKGIKFQILSNPEFLAEGTAIQDLFNPDRVLIGGRETPEGQKAVKALKDVYAHWVPED 680
            MVKICCIGAGYVGGPTMAVIALKCPSIEVAVVDIS SRI AWNSDQLPIYEPGLDGVVKQCRGKNLFFSTDVEKHV EADIVFVSVNTPTKTQGLGAGKAADLTYWESAAR+IADVSKSDKIVVEKSTVPVKTAEAIEKILTHNSKGIKFQILSNPEFLAEGTAI+DLFNPDRVLIGGRETPEGQKA++ LKDVYA WVPE+
Sbjct:    1 MVKICCIGAGYVGGPTMAVIALKCPSIEVAVVDISKSRIAAWNSDQLPIYEPGLDGVVKQCRGKNLFFSTDVEKHVFEADIVFVSVNTPTKTQGLGAGKAADLTYWESAARMIADVSKSDKIVVEKSTVPVKTAEAIEKILTHNSKGIKFQILSNPEFLAEGTAIKDLFNPDRVLIGGRETPEGQKAIQTLKDVYAQWVPEE 202          

HSP 2 Score: 33.4982 bits (75), Expect = 7.341e-110
Identity = 15/15 (100.00%), Postives = 15/15 (100.00%), Query Frame = 1
Query:  694 NLWSAELSKLAANAF 738
            NLWSAELSKLAANAF
Sbjct:  208 NLWSAELSKLAANAF 222          
BLAST of FC920414 vs. ExPASy Swiss-Prot
Match: UGDH1_ARATH (Probable UDP-glucose 6-dehydrogenase 1 OS=Arabidopsis thaliana GN=UGD1 PE=1 SV=1)

HSP 1 Score: 376.326 bits (965), Expect = 4.349e-107
Identity = 187/203 (92.12%), Postives = 194/203 (95.57%), Query Frame = 3
Query:   75 MVKICCIGAGYVGGPTMAVIALKCPSIEVAVVDISVSRINAWNSDQLPIYEPGLDGVVKQCRGKNLFFSTDVEKHVSEADIVFVSVNTPTKTQGLGAGKAADLTYWESAARVIADVSKSDKIVVEKSTVPVKTAEAIEKILTHNSKGIKFQILSNPEFLAEGTAIQDLFNPDRVLIGGRETPEGQKAVKALKDVYAHWVPEDE 683
            MVKICCIGAGYVGGPTMAVIALKCP +EVAVVDISV RINAWNSD LPIYEPGLD VVKQCRGKNLFFSTDVEKHV EADIVFVSVNTPTKT+GLGAGKAADLTYWESAAR+IADVS SDKIVVEKSTVPVKTAEAIEKILTHNSKGIKFQILSNPEFLAEGTAI+DLFNPDRVLIGGRETPEG KAV+ LK+VYAHWVPE +
Sbjct:    1 MVKICCIGAGYVGGPTMAVIALKCPDVEVAVVDISVPRINAWNSDTLPIYEPGLDDVVKQCRGKNLFFSTDVEKHVREADIVFVSVNTPTKTRGLGAGKAADLTYWESAARMIADVSVSDKIVVEKSTVPVKTAEAIEKILTHNSKGIKFQILSNPEFLAEGTAIKDLFNPDRVLIGGRETPEGFKAVQTLKNVYAHWVPEGQ 203          

HSP 2 Score: 33.4982 bits (75), Expect = 4.349e-107
Identity = 15/15 (100.00%), Postives = 15/15 (100.00%), Query Frame = 1
Query:  694 NLWSAELSKLAANAF 738
            NLWSAELSKLAANAF
Sbjct:  208 NLWSAELSKLAANAF 222          
BLAST of FC920414 vs. ExPASy Swiss-Prot
Match: UGDH2_ARATH (Probable UDP-glucose 6-dehydrogenase 2 OS=Arabidopsis thaliana GN=UGD2 PE=2 SV=1)

HSP 1 Score: 372.474 bits (955), Expect = 6.217e-106
Identity = 186/203 (91.63%), Postives = 192/203 (94.58%), Query Frame = 3
Query:   75 MVKICCIGAGYVGGPTMAVIALKCPSIEVAVVDISVSRINAWNSDQLPIYEPGLDGVVKQCRGKNLFFSTDVEKHVSEADIVFVSVNTPTKTQGLGAGKAADLTYWESAARVIADVSKSDKIVVEKSTVPVKTAEAIEKILTHNSKGIKFQILSNPEFLAEGTAIQDLFNPDRVLIGGRETPEGQKAVKALKDVYAHWVPEDE 683
            MVKICCIGAGYVGGPTMAVIALKCP IEVAVVDISV RINAWNSDQLPIYEPGLD +VKQCRGKNLFFSTDVEKHV EADIVFVSVNTPTKT GLGAGKAADLTYWESAAR+IADVS SDKIVVEKSTVPVKTAEAIEKIL HNSKGIKFQILSNPEFLAEGTAI DLFNPDRVLIGGRETPEG KAV+ LK+VYA+WVPE +
Sbjct:    1 MVKICCIGAGYVGGPTMAVIALKCPDIEVAVVDISVPRINAWNSDQLPIYEPGLDDIVKQCRGKNLFFSTDVEKHVREADIVFVSVNTPTKTTGLGAGKAADLTYWESAARMIADVSVSDKIVVEKSTVPVKTAEAIEKILMHNSKGIKFQILSNPEFLAEGTAIADLFNPDRVLIGGRETPEGFKAVQTLKEVYANWVPEGQ 203          

HSP 2 Score: 33.4982 bits (75), Expect = 6.217e-106
Identity = 15/15 (100.00%), Postives = 15/15 (100.00%), Query Frame = 1
Query:  694 NLWSAELSKLAANAF 738
            NLWSAELSKLAANAF
Sbjct:  208 NLWSAELSKLAANAF 222          
BLAST of FC920414 vs. ExPASy Swiss-Prot
Match: UGDH_DROME (UDP-glucose 6-dehydrogenase OS=Drosophila melanogaster GN=sgl PE=2 SV=1)

HSP 1 Score: 277.33 bits (708), Expect = 1.709e-76
Identity = 136/201 (67.66%), Postives = 163/201 (81.09%), Query Frame = 3
Query:   78 VKICCIGAGYVGGPTMAVIALKCPSIEVAVVDISVSRINAWNSDQLPIYEPGLDGVVKQCRGKNLFFSTDVEKHVSEADIVFVSVNTPTKTQGLGAGKAADLTYWESAARVIADVSKSDKIVVEKSTVPVKTAEAIEKILTHNSK-GIKFQILSNPEFLAEGTAIQDLFNPDRVLIGGRETPEGQKAVKALKDVYAHWVPE 677
            +K+CCIGAGYVGGPT AV+ALKCP I + +VD S  RI  WNSD+LPIYEPGLD VVK+CR  NLFFSTD+E  + EAD++F+SVNTPTKT G G G+AADL Y ESAAR+IA++++S+KIVVEKSTVPV+ AE+I  IL  N K GI + ILSNPEFLAEGTAI DL N DRVLIGG ETPEG +AV+ L  +Y HW+P+
Sbjct:    1 MKVCCIGAGYVGGPTCAVMALKCPDIVITLVDKSSERIAQWNSDKLPIYEPGLDEVVKKCRNVNLFFSTDIETAIKEADLIFISVNTPTKTCGNGKGRAADLKYVESAARMIAEIAQSNKIVVEKSTVPVRAAESIMHILRANQKPGIHYDILSNPEFLAEGTAINDLLNADRVLIGGEETPEGHQAVEKLSWIYEHWIPK 201          

HSP 2 Score: 30.4166 bits (67), Expect = 1.709e-76
Identity = 13/15 (86.67%), Postives = 14/15 (93.33%), Query Frame = 1
Query:  694 NLWSAELSKLAANAF 738
            N WS+ELSKLAANAF
Sbjct:  208 NTWSSELSKLAANAF 222          
BLAST of FC920414 vs. ExPASy Swiss-Prot
Match: UGDH_MOUSE (UDP-glucose 6-dehydrogenase OS=Mus musculus GN=Ugdh PE=1 SV=1)

HSP 1 Score: 272.322 bits (695), Expect = 5.398e-75
Identity = 135/202 (66.83%), Postives = 160/202 (79.21%), Query Frame = 3
Query:   81 KICCIGAGYVGGPTMAVIALKCPSIEVAVVDISVSRINAWNSDQLPIYEPGLDGVVKQCRGKNLFFSTDVEKHVSEADIVFVSVNTPTKTQGLGAGKAADLTYWESAARVIADVSKSDKIVVEKSTVPVKTAEAIEKILTHNSK-GIKFQILSNPEFLAEGTAIQDLFNPDRVLIGGRETPEGQKAVKALKDVYAHWVPEDE 683
            KICCIGAGYVGGPT +VIA  CP I V VVD++ +RINAWNS  LPIYEPGL  VV+ CRGKNLFFST+++  + EAD+VF+SVNTPTKT G+G G+AADL Y E+ AR I   S   KIV EKSTVPV+ AE+I +I   N+K  +  Q+LSNPEFLAEGTAI+DL NPDRVLIGG ETPEGQKAV+AL  VY HWVP+++
Sbjct:    6 KICCIGAGYVGGPTCSVIAHMCPEIRVTVVDVNEARINAWNSPTLPIYEPGLKEVVESCRGKNLFFSTNIDDAIREADLVFISVNTPTKTYGMGKGRAADLKYIEACARRIVQNSNGYKIVTEKSTVPVRAAESIRRIFDANTKPNLNLQVLSNPEFLAEGTAIKDLKNPDRVLIGGDETPEGQKAVRALCAVYEHWVPKEK 207          

HSP 2 Score: 30.4166 bits (67), Expect = 5.398e-75
Identity = 13/15 (86.67%), Postives = 14/15 (93.33%), Query Frame = 1
Query:  694 NLWSAELSKLAANAF 738
            N WS+ELSKLAANAF
Sbjct:  212 NTWSSELSKLAANAF 226          
BLAST of FC920414 vs. ExPASy Swiss-Prot
Match: UGDH_HUMAN (UDP-glucose 6-dehydrogenase OS=Homo sapiens GN=UGDH PE=1 SV=1)

HSP 1 Score: 271.937 bits (694), Expect = 7.039e-75
Identity = 135/202 (66.83%), Postives = 159/202 (78.71%), Query Frame = 3
Query:   81 KICCIGAGYVGGPTMAVIALKCPSIEVAVVDISVSRINAWNSDQLPIYEPGLDGVVKQCRGKNLFFSTDVEKHVSEADIVFVSVNTPTKTQGLGAGKAADLTYWESAARVIADVSKSDKIVVEKSTVPVKTAEAIEKILTHNSK-GIKFQILSNPEFLAEGTAIQDLFNPDRVLIGGRETPEGQKAVKALKDVYAHWVPEDE 683
            KICCIGAGYVGGPT +VIA  CP I V VVD++ SRINAWNS  LPIYEPGL  VV+ CRGKNLFFST+++  + EAD+VF+SVNTPTKT G+G G+AADL Y E+ AR I   S   KIV EKSTVPV+ AE+I +I   N+K  +  Q+LSNPEFLAEGTAI+DL NPDRVLIGG ETPEGQ+AV+AL  VY HWVP ++
Sbjct:    6 KICCIGAGYVGGPTCSVIAHMCPEIRVTVVDVNESRINAWNSPTLPIYEPGLKEVVESCRGKNLFFSTNIDDAIKEADLVFISVNTPTKTYGMGKGRAADLKYIEACARRIVQNSNGYKIVTEKSTVPVRAAESIRRIFDANTKPNLNLQVLSNPEFLAEGTAIKDLKNPDRVLIGGDETPEGQRAVQALCAVYEHWVPREK 207          

HSP 2 Score: 30.4166 bits (67), Expect = 7.039e-75
Identity = 13/15 (86.67%), Postives = 14/15 (93.33%), Query Frame = 1
Query:  694 NLWSAELSKLAANAF 738
            N WS+ELSKLAANAF
Sbjct:  212 NTWSSELSKLAANAF 226          
BLAST of FC920414 vs. ExPASy Swiss-Prot
Match: UGDH_CHICK (UDP-glucose 6-dehydrogenase OS=Gallus gallus GN=UGDH PE=2 SV=1)

HSP 1 Score: 271.552 bits (693), Expect = 9.181e-75
Identity = 133/202 (65.84%), Postives = 161/202 (79.70%), Query Frame = 3
Query:   81 KICCIGAGYVGGPTMAVIALKCPSIEVAVVDISVSRINAWNSDQLPIYEPGLDGVVKQCRGKNLFFSTDVEKHVSEADIVFVSVNTPTKTQGLGAGKAADLTYWESAARVIADVSKSDKIVVEKSTVPVKTAEAIEKILTHNSK-GIKFQILSNPEFLAEGTAIQDLFNPDRVLIGGRETPEGQKAVKALKDVYAHWVPEDE 683
            KICCIGAGYVGGPT +VIA  CP I+V VVD++ +RINAWNSD LPIYEPGL  VV+ CRG+NLFFST ++  + EAD+VF+SVNTPTKT G+G G+AADL Y E+ AR I   S   KIV EKSTVPV+ AE+I +I   N+K  +  Q+LSNPEFLAEGTAI+DL NPDRVLIGG ++PEGQKAV+AL  VY HWVP+++
Sbjct:    6 KICCIGAGYVGGPTCSVIAQMCPKIQVTVVDVNEARINAWNSDTLPIYEPGLKEVVESCRGRNLFFSTSIDDAIREADLVFISVNTPTKTYGMGKGRAADLKYIEACARRIVQNSNGYKIVTEKSTVPVRAAESIRRIFDANTKPNLDLQVLSNPEFLAEGTAIKDLKNPDRVLIGGDDSPEGQKAVRALCAVYEHWVPKEK 207          

HSP 2 Score: 30.4166 bits (67), Expect = 9.181e-75
Identity = 13/15 (86.67%), Postives = 14/15 (93.33%), Query Frame = 1
Query:  694 NLWSAELSKLAANAF 738
            N WS+ELSKLAANAF
Sbjct:  212 NTWSSELSKLAANAF 226          
BLAST of FC920414 vs. ExPASy Swiss-Prot
Match: UGDH_RAT (UDP-glucose 6-dehydrogenase OS=Rattus norvegicus GN=Ugdh PE=1 SV=1)

HSP 1 Score: 271.166 bits (692), Expect = 1.197e-74
Identity = 134/202 (66.34%), Postives = 160/202 (79.21%), Query Frame = 3
Query:   81 KICCIGAGYVGGPTMAVIALKCPSIEVAVVDISVSRINAWNSDQLPIYEPGLDGVVKQCRGKNLFFSTDVEKHVSEADIVFVSVNTPTKTQGLGAGKAADLTYWESAARVIADVSKSDKIVVEKSTVPVKTAEAIEKILTHNSK-GIKFQILSNPEFLAEGTAIQDLFNPDRVLIGGRETPEGQKAVKALKDVYAHWVPEDE 683
            KICCIGAGYVGGPT +VIA  CP I V VVD++ +RINAWNS  LPIYEPGL  VV+ CRGKNLFFST+++  + EAD+VF+SVNTPTKT G+G G+AADL Y E+ AR I   S   KIV EKSTVPV+ AE+I +I   N+K  +  Q+LSNPEFLAEGTAI+DL NPDRVLIGG ETPEGQ+AV+AL  VY HWVP+++
Sbjct:    6 KICCIGAGYVGGPTCSVIARMCPEIRVTVVDVNEARINAWNSPTLPIYEPGLKEVVESCRGKNLFFSTNIDDAIREADLVFISVNTPTKTYGMGKGRAADLKYIEACARRIVQNSNGYKIVTEKSTVPVRAAESIRRIFDANTKPNLNLQVLSNPEFLAEGTAIKDLKNPDRVLIGGDETPEGQRAVQALCAVYEHWVPKEK 207          

HSP 2 Score: 30.4166 bits (67), Expect = 1.197e-74
Identity = 13/15 (86.67%), Postives = 14/15 (93.33%), Query Frame = 1
Query:  694 NLWSAELSKLAANAF 738
            N WS+ELSKLAANAF
Sbjct:  212 NTWSSELSKLAANAF 226          
BLAST of FC920414 vs. ExPASy Swiss-Prot
Match: UGDH_BOVIN (UDP-glucose 6-dehydrogenase OS=Bos taurus GN=UGDH PE=1 SV=2)

HSP 1 Score: 271.937 bits (694), Expect = 2.037e-74
Identity = 136/202 (67.33%), Postives = 159/202 (78.71%), Query Frame = 3
Query:   81 KICCIGAGYVGGPTMAVIALKCPSIEVAVVDISVSRINAWNSDQLPIYEPGLDGVVKQCRGKNLFFSTDVEKHVSEADIVFVSVNTPTKTQGLGAGKAADLTYWESAARVIADVSKSDKIVVEKSTVPVKTAEAIEKILTHNSK-GIKFQILSNPEFLAEGTAIQDLFNPDRVLIGGRETPEGQKAVKALKDVYAHWVPEDE 683
            KICCIGAGYVGGPT +VIA  CP I V VVDI+ SRINAWNS  LPIYEPGL  VV+ CRGKNLFFST+++  + EAD+VF+SVNTPTKT G+G G+AADL Y E+ AR I   S   KIV EKSTVPV+ AE+I +I   N+K  +  Q+LSNPEFLAEGTAI+DL NPDRVLIGG ETPEGQ+AV+AL  VY HWVP ++
Sbjct:    6 KICCIGAGYVGGPTCSVIAHMCPEIRVTVVDINESRINAWNSPTLPIYEPGLKEVVESCRGKNLFFSTNIDDAIKEADLVFISVNTPTKTYGMGKGRAADLKYIEACARRIVQNSHGYKIVTEKSTVPVRAAESIRRIFDANTKPNLNLQVLSNPEFLAEGTAIKDLKNPDRVLIGGDETPEGQRAVQALCAVYEHWVPREK 207          

HSP 2 Score: 28.8758 bits (63), Expect = 2.037e-74
Identity = 12/15 (80.00%), Postives = 13/15 (86.67%), Query Frame = 1
Query:  694 NLWSAELSKLAANAF 738
            N WS+ELSKL ANAF
Sbjct:  212 NTWSSELSKLTANAF 226          
BLAST of FC920414 vs. ExPASy Swiss-Prot
Match: UGDH_PONAB (UDP-glucose 6-dehydrogenase OS=Pongo abelii GN=UGDH PE=2 SV=1)

HSP 1 Score: 267.314 bits (682), Expect = 1.705e-73
Identity = 134/202 (66.34%), Postives = 158/202 (78.22%), Query Frame = 3
Query:   81 KICCIGAGYVGGPTMAVIALKCPSIEVAVVDISVSRINAWNSDQLPIYEPGLDGVVKQCRGKNLFFSTDVEKHVSEADIVFVSVNTPTKTQGLGAGKAADLTYWESAARVIADVSKSDKIVVEKSTVPVKTAEAIEKILTHNSK-GIKFQILSNPEFLAEGTAIQDLFNPDRVLIGGRETPEGQKAVKALKDVYAHWVPEDE 683
            KICCIGAGYVGGPT +VIA   P I V VVD++ SRINAWNS  LPIYEPGL  VV+ CRGKNLFFST+++  + EAD+VF+SVNTPTKT G+G G+AADL Y E+ AR I   S   KIV EKSTVPV+ AE+I +I   N+K  +  Q+LSNPEFLAEGTAI+DL NPDRVLIGG ETPEGQ+AV+AL  VY HWVP ++
Sbjct:    6 KICCIGAGYVGGPTCSVIAHMRPEIRVTVVDVNESRINAWNSPTLPIYEPGLKEVVESCRGKNLFFSTNIDDAIKEADLVFISVNTPTKTYGMGKGRAADLKYIEACARRIVQNSNGYKIVTEKSTVPVRAAESIRRIFDANTKPNLNLQVLSNPEFLAEGTAIKDLKNPDRVLIGGDETPEGQRAVQALCAVYEHWVPREK 207          

HSP 2 Score: 30.4166 bits (67), Expect = 1.705e-73
Identity = 13/15 (86.67%), Postives = 14/15 (93.33%), Query Frame = 1
Query:  694 NLWSAELSKLAANAF 738
            N WS+ELSKLAANAF
Sbjct:  212 NTWSSELSKLAANAF 226          
The following BLAST results are available for this feature:
BLAST of FC920414 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 38
Match NameE-valueIdentityDescription
UGDH_SOYBN7.341e-11095.05UDP-glucose 6-dehydrogenase OS=Glycine max PE=2 SV... [more]
UGDH1_ARATH4.349e-10792.12Probable UDP-glucose 6-dehydrogenase 1 OS=Arabidop... [more]
UGDH2_ARATH6.217e-10691.63Probable UDP-glucose 6-dehydrogenase 2 OS=Arabidop... [more]
UGDH_DROME1.709e-7667.66UDP-glucose 6-dehydrogenase OS=Drosophila melanoga... [more]
UGDH_MOUSE5.398e-7566.83UDP-glucose 6-dehydrogenase OS=Mus musculus GN=Ugd... [more]
UGDH_HUMAN7.039e-7566.83UDP-glucose 6-dehydrogenase OS=Homo sapiens GN=UGD... [more]
UGDH_CHICK9.181e-7565.84UDP-glucose 6-dehydrogenase OS=Gallus gallus GN=UG... [more]
UGDH_RAT1.197e-7466.34UDP-glucose 6-dehydrogenase OS=Rattus norvegicus G... [more]
UGDH_BOVIN2.037e-7467.33UDP-glucose 6-dehydrogenase OS=Bos taurus GN=UGDH ... [more]
UGDH_PONAB1.705e-7366.34UDP-glucose 6-dehydrogenase OS=Pongo abelii GN=UGD... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32008A11EF RVDevelop1 Citrus clementina cDNA clone C32008A11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920414 ID=FC920414|Name=FC920414|organism=Citrus clementina|type=EST|length=738bp
GATCGTTGTAGAAACAGTTGTTTTGATTTTGAGAAATCGAAGCTCACTGA
GGTTATATTGATTAGTAAAGGAAAATGGTGAAGATCTGCTGCATCGGTGC
TGGGTATGTTGGGGGGCCGACAATGGCAGTCATTGCACTGAAGTGCCCAT
CCATTGAAGTGGCTGTTGTTGATATCTCTGTGTCTCGGATCAATGCCTGG
AACAGTGACCAGCTCCCCATCTATGAGCCTGGACTTGATGGTGTGGTAAA
GCAGTGCCGAGGGAAGAACCTGTTCTTCAGCACCGATGTTGAGAAGCATG
TCTCTGAGGCTGATATTGTCTTTGTTTCGGTCAATACCCCAACTAAAACT
CAGGGTCTTGGTGCTGGCAAAGCTGCAGATCTGACATACTGGGAGAGCGC
TGCTCGTGTGATTGCCGATGTGTCAAAGTCTGACAAAATTGTTGTTGAGA
AATCAACAGTTCCTGTAAAAACTGCTGAGGCAATTGAAAAAATTTTGACC
CACAACAGCAAGGGAATCAAATTCCAGATCCTTTCAAACCCGGAGTTTCT
TGCTGAGGGAACTGCAATACAGGATCTTTTTAACCCAGATCGGGTCCTTA
TCGGTGGTAGAGAAACGCCAGAAGGCCAGAAAGCCGTCAAAGCCTTGAAG
GATGTGTATGCACACTGGGTCCCAGAAGACGAATTTTGACCACAACCTCT
GGTCTGCAGAGCTTTCGAAGCTTGCAGCCAATGCTTTC
back to top