FC920416

Overview
NameFC920416
Unique NameFC920416
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length670
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC920416 vs. ExPASy Swiss-Prot
Match: RNZN_ARATH (Nuclear ribonuclease Z OS=Arabidopsis thaliana GN=NUZ PE=2 SV=3)

HSP 1 Score: 314.694 bits (805), Expect = 2.759e-85
Identity = 149/196 (76.02%), Postives = 171/196 (87.24%), Query Frame = 3
Query:   81 RGMQLQGYKVEGLSIAGHETCIIFPSLDLAFDIGRCPSRALSQNFLFISHAHMDHIGGLPMYVATRGLYRMKPPTIIVPSCIKEDVEQLFEIHRRMDHSELNHTLVGLDVGEEFCMRKDLFVKAFKTYHVIQSQGYVVYSVKQKLKQEYLGLPGDEIKKLKSSGTEITYTVTTPEVAFTGDTMSDFIVDEANIDVL 668
            + MQ++GY +EGLSI GHETCIIFPSL +AFDIGRCP RA+SQ+FLFISH+HMDHIGGLPMYVATRGLY+MKPPTIIVP+ IKE VE LFE+HR++D SEL H LVGLD+GEEF +RKDL VKAFKT+HVIQSQGYVVYS K KLK+EY+GL G+EIK LK SG EIT ++ TPEVAFTGDT SDF+VDE N D L
Sbjct:    5 KAMQIEGYPIEGLSIGGHETCIIFPSLRIAFDIGRCPHRAISQDFLFISHSHMDHIGGLPMYVATRGLYKMKPPTIIVPASIKETVESLFEVHRKLDSSELKHNLVGLDIGEEFIIRKDLKVKAFKTFHVIQSQGYVVYSTKYKLKKEYIGLSGNEIKNLKVSGVEITDSIITPEVAFTGDTTSDFVVDETNADAL 200          
BLAST of FC920416 vs. ExPASy Swiss-Prot
Match: RNZN_WHEAT (Nuclear ribonuclease Z (Fragment) OS=Triticum aestivum GN=ELAC PE=1 SV=1)

HSP 1 Score: 271.552 bits (693), Expect = 2.679e-72
Identity = 125/170 (73.53%), Postives = 151/170 (88.82%), Query Frame = 3
Query:   87 MQLQGYKVEGLSIAGHETCIIFPSLDLAFDIGRCPSRALSQNFLFISHAHMDHIGGLPMYVATRGLYRMKPPTIIVPSCIKEDVEQLFEIHRRMDHSELNHTLVGLDVGEEFCMRKDLFVKAFKTYHVIQSQGYVVYSVKQKLKQEYLGLPGDEIKKLKSSGTEITYTVT 596
            ++++GY VEG+SI GHETC+IFP+L LAFDIGRCP RA++Q+FLFISHAH+DHIGGLPMYVATRGLYR++PPTI VP  ++E VE+LF++HR MD SELNHTLV LD+GEE+ +R+DL V+AFKTYH I SQGYV+YSVKQKLKQ+YLGLPG EIK+LK SG EIT TVT
Sbjct:    7 LEIEGYPVEGISIGGHETCVIFPTLSLAFDIGRCPQRAVAQDFLFISHAHLDHIGGLPMYVATRGLYRLRPPTIFVPKYLRELVERLFDVHRAMDQSELNHTLVPLDIGEEYELRRDLKVRAFKTYHTIPSQGYVIYSVKQKLKQDYLGLPGSEIKRLKLSGVEITNTVT 176          
BLAST of FC920416 vs. ExPASy Swiss-Prot
Match: RNZC_ARATH (Ribonuclease Z, chloroplastic OS=Arabidopsis thaliana GN=CPZ PE=2 SV=1)

HSP 1 Score: 252.292 bits (643), Expect = 1.682e-66
Identity = 115/196 (58.67%), Postives = 152/196 (77.55%), Query Frame = 3
Query:   81 RGMQLQGYKVEGLSIAGHETCIIFPSLDLAFDIGRCPSRALSQNFLFISHAHMDHIGGLPMYVATRGLYRMKPPTIIVPSCIKEDVEQLFEIHRRMDHSELNHTLVGLDVGEEFCMRKDLFVKAFKTYHVIQSQGYVVYSVKQKLKQEYLGLPGDEIKKLKSSGTEITYTVTTPEVAFTGDTMSDFIVDEANIDVL 668
            +G++L+ Y +EG+S+ GHETC+I P L   FDIGRCPSRA+ Q FLFI+HAH+DHIGGLPMYVA+RGLY ++PP I VP  IKEDVE+L EIHR M   ELN  L+ L VGE + +R D+ V+ F T+HVI SQGYV+YSV++KL+++Y  L G +I+K+K SG EIT T+ +PE+AFTGDT S++++D  N D L
Sbjct:   74 KGVELESYAIEGISVGGHETCVIVPELKCVFDIGRCPSRAIQQKFLFITHAHLDHIGGLPMYVASRGLYNLEPPKIFVPPSIKEDVEKLLEIHRTMGQVELNVELIPLAVGETYELRNDIVVRPFATHHVIPSQGYVIYSVRKKLQKQYAHLKGKQIEKIKKSGVEITDTILSPEIAFTGDTTSEYMLDPRNADAL 269          
The following BLAST results are available for this feature:
BLAST of FC920416 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
RNZN_ARATH2.759e-8576.02Nuclear ribonuclease Z OS=Arabidopsis thaliana GN=... [more]
RNZN_WHEAT2.679e-7273.53Nuclear ribonuclease Z (Fragment) OS=Triticum aest... [more]
RNZC_ARATH1.682e-6658.67Ribonuclease Z, chloroplastic OS=Arabidopsis thali... [more]
back to top
Properties
Property NameValue
Genbank descriptionC32008B03EF RVDevelop1 Citrus clementina cDNA clone C32008B03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920416 ID=FC920416|Name=FC920416|organism=Citrus clementina|type=EST|length=670bp
GGACCCATTGATGATTGATTGCTCTGCAGTCGTTGAACTACAGAATGGCC
ACGAAAGCCAAAGAAGAGGAGAAGAGCGGGAGGGGGATGCAATTACAAGG
GTACAAAGTAGAAGGATTGTCGATAGCAGGCCACGAGACTTGCATTATTT
TCCCCTCTCTCGATTTAGCATTCGATATTGGACGATGCCCTTCTCGAGCT
CTCTCTCAAAATTTCCTCTTTATCTCCCACGCCCACATGGATCACATTGG
AGGATTGCCCATGTATGTCGCTACCAGAGGCCTGTACCGCATGAAGCCCC
CCACAATTATTGTTCCCTCTTGTATTAAAGAAGATGTGGAACAACTCTTT
GAGATTCATAGAAGGATGGATCATTCTGAGCTGAACCATACACTGGTTGG
CTTGGATGTGGGGGAAGAGTTTTGCATGAGAAAGGACCTTTTTGTAAAAG
CCTTCAAAACTTACCATGTTATACAAAGCCAGGGTTACGTAGTTTACTCC
GTGAAGCAGAAACTTAAACAAGAGTACCTTGGCCTTCCTGGGGATGAGAT
TAAGAAATTGAAGTCGTCAGGCACGGAGATTACATATACCGTGACGACAC
CTGAAGTTGCTTTTACAGGAGACACAATGTCCGATTTTATCGTTGATGAA
GCTAATATTGATGTTTTGAG
back to top