FC920418

Overview
NameFC920418
Unique NameFC920418
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length673
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15452 contig Ccv1_Contig15452:3..675. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920418 vs. ExPASy Swiss-Prot
Match: CATA3_MAIZE (Catalase isozyme 3 OS=Zea mays GN=CAT3 PE=2 SV=2)

HSP 1 Score: 350.517 bits (898), Expect = 4.621e-96
Identity = 159/197 (80.71%), Postives = 177/197 (89.85%), Query Frame = 2
Query:   83 IAMDPYKLLPSTTHNAPFMTTNAGAPVWNDNHSLTVGSRGPVLLEDYHLVEKLAHFARERIPERVVHARGASAKGFFECTHDISHLTCADLFRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNWDLLGNSIPVFFIRDAIKFPDVIHAFKPNPKSHIQEYWRILDFCSHLPESLSTFSWFFDDVGI 673
            + MDP K  PS++H+    TTNAGAPVWNDN +LTVG RGP+LLEDYHL+EK+AHFARERIPERVVHARGASAKGFFECTHD++ LTCAD  RAPGV+TPVIVRFSTVIHERGSPET+RDPRGFAVKFYTREGNWDLLGN+ PVFFIRD IKFPDVIHAFKPNP+SH+QEYWR+ DF SHLPESL TF + FDDVG+
Sbjct:    1 MTMDPTKFRPSSSHDTTVTTTNAGAPVWNDNEALTVGPRGPILLEDYHLIEKVAHFARERIPERVVHARGASAKGFFECTHDVTSLTCADFLRAPGVRTPVIVRFSTVIHERGSPETIRDPRGFAVKFYTREGNWDLLGNNFPVFFIRDGIKFPDVIHAFKPNPRSHVQEYWRVFDFLSHLPESLHTFFFLFDDVGV 197          
BLAST of FC920418 vs. ExPASy Swiss-Prot
Match: CATA_AVIMR (Catalase OS=Avicennia marina PE=2 SV=1)

HSP 1 Score: 350.132 bits (897), Expect = 6.035e-96
Identity = 162/195 (83.08%), Postives = 177/195 (90.77%), Query Frame = 2
Query:   89 MDPYKLLPSTTHNAPFMTTNAGAPVWNDNHSLTVGSRGPVLLEDYHLVEKLAHFARERIPERVVHARGASAKGFFECTHDISHLTCADLFRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNWDLLGNSIPVFFIRDAIKFPDVIHAFKPNPKSHIQEYWRILDFCSHLPESLSTFSWFFDDVGI 673
            MDPYK  PS++ N P  TTN G PV+NDN SLTVG+RGPVLLEDY L++KLAHF RERIPERVVHARGA+AKGFFE THD+SHLTCAD  RAPGVQTP+IVRFSTVIHERGSPETLRDPRGFAVKFYTREGN+D++GN+ PVFFIRDAIKFPDVIHAFKPNPKSHIQE WRILDFCSH PESL TF+WF+DDVGI
Sbjct:    1 MDPYKYCPSSSFNTPHTTTNGGHPVYNDNSSLTVGTRGPVLLEDYQLIDKLAHFTRERIPERVVHARGATAKGFFEVTHDVSHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDIVGNNFPVFFIRDAIKFPDVIHAFKPNPKSHIQESWRILDFCSHFPESLLTFAWFYDDVGI 195          
BLAST of FC920418 vs. ExPASy Swiss-Prot
Match: CATA2_RICCO (Catalase isozyme 2 OS=Ricinus communis GN=CAT2 PE=2 SV=1)

HSP 1 Score: 344.739 bits (883), Expect = 2.535e-94
Identity = 158/195 (81.03%), Postives = 176/195 (90.26%), Query Frame = 2
Query:   89 MDPYKLLPSTTHNAPFMTTNAGAPVWNDNHSLTVGSRGPVLLEDYHLVEKLAHFARERIPERVVHARGASAKGFFECTHDISHLTCADLFRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNWDLLGNSIPVFFIRDAIKFPDVIHAFKPNPKSHIQEYWRILDFCSHLPESLSTFSWFFDDVGI 673
            MDPYK  PS++++ PF TTNAG PV N+N S+TVG RGP+LLEDYH++EKLA+F RERIPERVVHARG SAKGFFE THD++ LTCAD  RAPGVQTPVIVRFSTVIHERGSPETLRDPRGFA KFYTREGN+D++GN+ PVFFIRD IKFPDV+HAFKPNPKSHIQEYWRI DFCSH PESLSTF+WFFDDVGI
Sbjct:    1 MDPYKFRPSSSNDTPFWTTNAGDPVSNNNSSMTVGPRGPILLEDYHMIEKLANFTRERIPERVVHARGMSAKGFFEVTHDVTDLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFATKFYTREGNFDIVGNNFPVFFIRDGIKFPDVVHAFKPNPKSHIQEYWRIFDFCSHHPESLSTFAWFFDDVGI 195          
BLAST of FC920418 vs. ExPASy Swiss-Prot
Match: CATA_PHAAU (Catalase OS=Phaseolus aureus PE=2 SV=1)

HSP 1 Score: 342.428 bits (877), Expect = 1.258e-93
Identity = 157/195 (80.51%), Postives = 178/195 (91.28%), Query Frame = 2
Query:   89 MDPYKLLPSTTHNAPFMTTNAGAPVWNDNHSLTVGSRGPVLLEDYHLVEKLAHFARERIPERVVHARGASAKGFFECTHDISHLTCADLFRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNWDLLGNSIPVFFIRDAIKFPDVIHAFKPNPKSHIQEYWRILDFCSHLPESLSTFSWFFDDVGI 673
            MDPYK  PS+  N+PF TTN+GAPVWN+N+SLTVG+RGP+LLEDYHLVEKLA+F RERIPERVVHARGASAKGFFE THD+SHLTCAD  RAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGN+DL+GN++PVFF+RD +KFPD++HA KPNPK+HIQE WRILDF SH PESL  FS+ FDD+G+
Sbjct:    1 MDPYKYRPSSAFNSPFWTTNSGAPVWNNNNSLTVGTRGPILLEDYHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNLPVFFVRDGMKFPDMVHALKPNPKNHIQENWRILDFFSHFPESLHMFSFLFDDLGV 195          
BLAST of FC920418 vs. ExPASy Swiss-Prot
Match: CATA3_SOYBN (Catalase-3 OS=Glycine max GN=CAT3 PE=2 SV=1)

HSP 1 Score: 342.043 bits (876), Expect = 1.643e-93
Identity = 160/195 (82.05%), Postives = 176/195 (90.26%), Query Frame = 2
Query:   89 MDPYKLLPSTTHNAPFMTTNAGAPVWNDNHSLTVGSRGPVLLEDYHLVEKLAHFARERIPERVVHARGASAKGFFECTHDISHLTCADLFRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNWDLLGNSIPVFFIRDAIKFPDVIHAFKPNPKSHIQEYWRILDFCSHLPESLSTFSWFFDDVGI 673
            MDPYK  PS+  N+PF TTN+GAP+WN+N SLTVGSRGP+LLEDYHLVEKLA+F RERIPERVVHARGASAKGFFE THDISHLTCAD  RAPGVQTP+IVRFSTVIHERGSPETLRDPRGFAVKFYTREGN+DL+GN+ PVFF+RD +KFPD++HA KPNPKSHIQE WRILDF SH PESL  FS+ FDDVGI
Sbjct:    1 MDPYKNRPSSAFNSPFWTTNSGAPIWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGLKFPDMVHALKPNPKSHIQENWRILDFFSHHPESLHMFSFLFDDVGI 195          
BLAST of FC920418 vs. ExPASy Swiss-Prot
Match: CATA1_SOYBN (Catalase-1/2 OS=Glycine max GN=CAT1 PE=2 SV=1)

HSP 1 Score: 342.043 bits (876), Expect = 1.643e-93
Identity = 160/195 (82.05%), Postives = 176/195 (90.26%), Query Frame = 2
Query:   89 MDPYKLLPSTTHNAPFMTTNAGAPVWNDNHSLTVGSRGPVLLEDYHLVEKLAHFARERIPERVVHARGASAKGFFECTHDISHLTCADLFRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNWDLLGNSIPVFFIRDAIKFPDVIHAFKPNPKSHIQEYWRILDFCSHLPESLSTFSWFFDDVGI 673
            MDPYK  PS+  N+PF TTN+GAP+WN+N SLTVGSRGP+LLEDYHLVEKLA+F RERIPERVVHARGASAKGFFE THDISHLTCAD  RAPGVQTP+IVRFSTVIHERGSPETLRDPRGFAVKFYTREGN+DL+GN+ PVFF+RD +KFPD++HA KPNPKSHIQE WRILDF SH PESL  FS+ FDDVGI
Sbjct:    1 MDPYKNRPSSAFNSPFWTTNSGAPIWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGLKFPDMVHALKPNPKSHIQENWRILDFFSHHPESLHMFSFLFDDVGI 195          
BLAST of FC920418 vs. ExPASy Swiss-Prot
Match: CATA1_ORYSJ (Catalase isozyme A OS=Oryza sativa subsp. japonica GN=CATA PE=2 SV=1)

HSP 1 Score: 342.043 bits (876), Expect = 1.643e-93
Identity = 156/195 (80.00%), Postives = 173/195 (88.72%), Query Frame = 2
Query:   89 MDPYKLLPSTTHNAPFMTTNAGAPVWNDNHSLTVGSRGPVLLEDYHLVEKLAHFARERIPERVVHARGASAKGFFECTHDISHLTCADLFRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNWDLLGNSIPVFFIRDAIKFPDVIHAFKPNPKSHIQEYWRILDFCSHLPESLSTFSWFFDDVGI 673
            MDP K  PS++ +    TTNAGAPVWNDN +LTVG RGP+LLEDYHL+EK+AHFARERIPERVVHARGASAKGFFECTHD++ +TCAD  R+PG QTPVIVRFSTVIHERGSPET+RDPRGFAVKFYTREGNWDLLGN+ PVFFIRD IKFPDVIHAFKPNP+SH+QEYWR+ DF SH PESL TF + FDDVGI
Sbjct:    1 MDPCKFRPSSSFDTKTTTTNAGAPVWNDNEALTVGPRGPILLEDYHLIEKVAHFARERIPERVVHARGASAKGFFECTHDVTDITCADFLRSPGAQTPVIVRFSTVIHERGSPETIRDPRGFAVKFYTREGNWDLLGNNFPVFFIRDGIKFPDVIHAFKPNPRSHVQEYWRVFDFLSHHPESLHTFFFLFDDVGI 195          
BLAST of FC920418 vs. ExPASy Swiss-Prot
Match: CATA1_ORYSI (Catalase isozyme A OS=Oryza sativa subsp. indica PE=2 SV=1)

HSP 1 Score: 342.043 bits (876), Expect = 1.643e-93
Identity = 156/195 (80.00%), Postives = 173/195 (88.72%), Query Frame = 2
Query:   89 MDPYKLLPSTTHNAPFMTTNAGAPVWNDNHSLTVGSRGPVLLEDYHLVEKLAHFARERIPERVVHARGASAKGFFECTHDISHLTCADLFRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNWDLLGNSIPVFFIRDAIKFPDVIHAFKPNPKSHIQEYWRILDFCSHLPESLSTFSWFFDDVGI 673
            MDP K  PS++ +    TTNAGAPVWNDN +LTVG RGP+LLEDYHL+EK+AHFARERIPERVVHARGASAKGFFECTHD++ +TCAD  R+PG QTPVIVRFSTVIHERGSPET+RDPRGFAVKFYTREGNWDLLGN+ PVFFIRD IKFPDVIHAFKPNP+SH+QEYWR+ DF SH PESL TF + FDDVGI
Sbjct:    1 MDPCKFRPSSSFDTKTTTTNAGAPVWNDNEALTVGPRGPILLEDYHLIEKVAHFARERIPERVVHARGASAKGFFECTHDVTDITCADFLRSPGAQTPVIVRFSTVIHERGSPETIRDPRGFAVKFYTREGNWDLLGNNFPVFFIRDGIKFPDVIHAFKPNPRSHVQEYWRVFDFLSHHPESLHTFFFLFDDVGI 195          
BLAST of FC920418 vs. ExPASy Swiss-Prot
Match: CATA_IPOBA (Catalase OS=Ipomoea batatas PE=2 SV=1)

HSP 1 Score: 340.887 bits (873), Expect = 3.661e-93
Identity = 157/195 (80.51%), Postives = 175/195 (89.74%), Query Frame = 2
Query:   89 MDPYKLLPSTTHNAPFMTTNAGAPVWNDNHSLTVGSRGPVLLEDYHLVEKLAHFARERIPERVVHARGASAKGFFECTHDISHLTCADLFRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNWDLLGNSIPVFFIRDAIKFPDVIHAFKPNPKSHIQEYWRILDFCSHLPESLSTFSWFFDDVGI 673
            MDP K  PS++ N PF TTN+GAPVWN+  +LTVGSRGP+LLEDYHLVEK+ +F RERIPERVVHARGASAKGFFE THDI+HLTCAD  RAPGVQTP+IVRFSTVIHERGSPET+RDPRGFAVK YTR GNWDL+GN+ PVFFIRD  +FPDVIHAFKPNPKSHIQE WRILD+ SHLPESL+TF+WF+DDVGI
Sbjct:    1 MDPSKYRPSSSFNTPFCTTNSGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIPERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPRGFAVKMYTRGGNWDLVGNNFPVFFIRDGTQFPDVIHAFKPNPKSHIQENWRILDYLSHLPESLNTFAWFYDDVGI 195          
BLAST of FC920418 vs. ExPASy Swiss-Prot
Match: CATA2_HORVU (Catalase isozyme 2 OS=Hordeum vulgare GN=CAT2 PE=2 SV=1)

HSP 1 Score: 340.887 bits (873), Expect = 3.661e-93
Identity = 157/195 (80.51%), Postives = 172/195 (88.21%), Query Frame = 2
Query:   89 MDPYKLLPSTTHNAPFMTTNAGAPVWNDNHSLTVGSRGPVLLEDYHLVEKLAHFARERIPERVVHARGASAKGFFECTHDISHLTCADLFRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNWDLLGNSIPVFFIRDAIKFPDVIHAFKPNPKSHIQEYWRILDFCSHLPESLSTFSWFFDDVGI 673
            MDP K  PS++ +    TTNAG PVWNDN +LTVG RGP+LLEDYHL+EK+AHFARERIPERVVHARGASAKGFFECTHD++ LTCAD  RAPG +TPVIVRFSTVIHERGSPET+RDPRGFAVKFYTREGNWDLLGN+ PVFFIRD IKFPDVIHAFKPNPKSH+QEYWR+ DF SH PESL TF + FDDVGI
Sbjct:    1 MDPCKFRPSSSFDTKTTTTNAGQPVWNDNEALTVGPRGPILLEDYHLLEKIAHFARERIPERVVHARGASAKGFFECTHDVTGLTCADFLRAPGARTPVIVRFSTVIHERGSPETIRDPRGFAVKFYTREGNWDLLGNNFPVFFIRDGIKFPDVIHAFKPNPKSHVQEYWRVFDFLSHHPESLHTFFFLFDDVGI 195          
The following BLAST results are available for this feature:
BLAST of FC920418 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 141
Match NameE-valueIdentityDescription
CATA3_MAIZE4.621e-9680.71Catalase isozyme 3 OS=Zea mays GN=CAT3 PE=2 SV=2[more]
CATA_AVIMR6.035e-9683.08Catalase OS=Avicennia marina PE=2 SV=1[more]
CATA2_RICCO2.535e-9481.03Catalase isozyme 2 OS=Ricinus communis GN=CAT2 PE=... [more]
CATA_PHAAU1.258e-9380.51Catalase OS=Phaseolus aureus PE=2 SV=1[more]
CATA3_SOYBN1.643e-9382.05Catalase-3 OS=Glycine max GN=CAT3 PE=2 SV=1[more]
CATA1_SOYBN1.643e-9382.05Catalase-1/2 OS=Glycine max GN=CAT1 PE=2 SV=1[more]
CATA1_ORYSJ1.643e-9380.00Catalase isozyme A OS=Oryza sativa subsp. japonica... [more]
CATA1_ORYSI1.643e-9380.00Catalase isozyme A OS=Oryza sativa subsp. indica P... [more]
CATA_IPOBA3.661e-9380.51Catalase OS=Ipomoea batatas PE=2 SV=1[more]
CATA2_HORVU3.661e-9380.51Catalase isozyme 2 OS=Hordeum vulgare GN=CAT2 PE=2... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32008B05EF RVDevelop1 Citrus clementina cDNA clone C32008B05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920418 ID=FC920418|Name=FC920418|organism=Citrus clementina|type=EST|length=673bp
ACACTCTTCTTGAGTCTCGACTCAACTCCACTTCTCCTTTCTTACGATAA
TAATAACAGTAGCAAAATCTTCAGCAAGAAATATCGCCATGGATCCCTAC
AAATTGCTTCCGTCAACTACTCACAATGCCCCCTTTATGACTACAAATGC
CGGCGCTCCTGTCTGGAACGACAATCACTCCTTGACTGTTGGAAGTAGAG
GTCCTGTCCTTCTTGAGGATTATCATCTGGTGGAGAAACTAGCTCATTTT
GCCAGGGAGAGGATTCCAGAACGCGTCGTCCATGCTAGGGGAGCCAGTGC
TAAGGGTTTCTTTGAGTGCACCCATGATATTTCTCACCTTACTTGTGCTG
ATCTTTTTCGAGCTCCAGGGGTTCAGACACCTGTCATTGTTCGCTTCTCC
ACTGTTATCCATGAGCGGGGCAGCCCTGAGACACTCAGGGATCCTCGAGG
ATTTGCAGTCAAGTTTTACACCAGAGAGGGTAATTGGGATCTTCTGGGTA
ACAGTATCCCTGTTTTTTTCATCCGTGATGCAATCAAATTCCCAGATGTG
ATCCATGCTTTTAAACCTAATCCAAAGTCTCACATCCAAGAGTACTGGAG
GATCCTCGACTTCTGCTCCCACCTTCCTGAAAGCTTGTCCACATTTTCCT
GGTTCTTTGATGATGTGGGTATT
back to top