FC920419

Overview
NameFC920419
Unique NameFC920419
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length477
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9765 contig Ccv1_Contig9765:45..520. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920419 vs. ExPASy Swiss-Prot
Match: CB4B_SOLLC (Chlorophyll a-b binding protein CP24 10B, chloroplastic OS=Solanum lycopersicum GN=CAP10B PE=3 SV=1)

HSP 1 Score: 139.428 bits (350), Expect = 7.769e-33
Identity = 63/64 (98.44%), Postives = 64/64 (100.00%), Query Frame = 1
Query:  286 GFDPLGLGKDPAFLKWYREAELIHGRWAMAAVVGIFVGQAWSGIPWFEAGADPGAIAPFSFGSL 477
            GFDPLGLGKDPAFLKWYREAELIHGRWAMAAV+GIFVGQAWSGIPWFEAGADPGAIAPFSFGSL
Sbjct:   80 GFDPLGLGKDPAFLKWYREAELIHGRWAMAAVLGIFVGQAWSGIPWFEAGADPGAIAPFSFGSL 143          

HSP 2 Score: 93.5893 bits (231), Expect = 4.795e-19
Identity = 50/91 (54.95%), Postives = 59/91 (64.84%), Query Frame = 3
Query:   57 MAAATSGAVLNGLGSSFINGGKKSQALLAG--TNRVTXXXXXXXXXX-LPPKKSWIPAVKGGGNLINPEWLDGSLPGDYRIRPTWAWKGPS 320
            M   ++ AVLNGL SSF+ GGKK+QALL    T RVT           + PKKSWIPAVK GGNL++PEWLDGSLPGD+   P    K P+
Sbjct:    1 MTTTSATAVLNGLSSSFLTGGKKTQALLGAHVTARVTTPKRFVVAAAAVAPKKSWIPAVKSGGNLVDPEWLDGSLPGDFGFDPLGLGKDPA 91          
BLAST of FC920419 vs. ExPASy Swiss-Prot
Match: CB4A_SOLLC (Chlorophyll a-b binding protein CP24 10A, chloroplastic OS=Solanum lycopersicum GN=CAP10A PE=3 SV=1)

HSP 1 Score: 138.272 bits (347), Expect = 1.731e-32
Identity = 62/64 (96.88%), Postives = 64/64 (100.00%), Query Frame = 1
Query:  286 GFDPLGLGKDPAFLKWYREAELIHGRWAMAAVVGIFVGQAWSGIPWFEAGADPGAIAPFSFGSL 477
            GFDPLGLGKDPAFLKWYREAELIHGRWAMAAV+GIFVGQAWSGIPWFEAGADPGAIAPFSFG+L
Sbjct:   80 GFDPLGLGKDPAFLKWYREAELIHGRWAMAAVLGIFVGQAWSGIPWFEAGADPGAIAPFSFGTL 143          

HSP 2 Score: 93.2041 bits (230), Expect = 6.262e-19
Identity = 52/90 (57.78%), Postives = 57/90 (63.33%), Query Frame = 3
Query:   63 AATSGAVLNGLGSSFINGGKKSQALLAG--TNRVTXXXXXXXXXXLPP--KKSWIPAVKGGGNLINPEWLDGSLPGDYRIRPTWAWKGPS 320
            A TS AVLNGL SSF+ GG KSQALLA     RV           L    KKSWIPAV+GGGNL++PEWLDGSLPGDY   P    K P+
Sbjct:    2 ATTSAAVLNGLSSSFLTGGNKSQALLAAPLAARVGGAATPKRFTVLAAAAKKSWIPAVRGGGNLVDPEWLDGSLPGDYGFDPLGLGKDPA 91          
BLAST of FC920419 vs. ExPASy Swiss-Prot
Match: CB4_SPIOL (Chlorophyll a-b binding protein CP24, chloroplastic OS=Spinacia oleracea PE=2 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 1.914e-31
Identity = 59/64 (92.19%), Postives = 63/64 (98.44%), Query Frame = 1
Query:  286 GFDPLGLGKDPAFLKWYREAELIHGRWAMAAVVGIFVGQAWSGIPWFEAGADPGAIAPFSFGSL 477
            GFDPLGLGKDPAFLKWYREAELIHGRWAM AV+GIFVGQAW+GIPWFEAGADPGA+APFSFG+L
Sbjct:   85 GFDPLGLGKDPAFLKWYREAELIHGRWAMLAVLGIFVGQAWTGIPWFEAGADPGAVAPFSFGTL 148          

HSP 2 Score: 85.8853 bits (211), Expect = 9.998e-17
Identity = 49/96 (51.04%), Postives = 60/96 (62.50%), Query Frame = 3
Query:   57 MAAATSG-AVLNGLGSSFINGGKKS-QALLAGTNRV------TXXXXXXXXXXLPPKKSWIPAVKGGGNLINPEWLDGSLPGDYRIRPTWAWKGPS 320
            MAAATS  A++NG  S F++GGKKS Q+LL   ++V      T            PKKSWIPAVKGGGN ++PEWLDGSLPGD+   P    K P+
Sbjct:    1 MAAATSATAIVNGFTSPFLSGGKKSSQSLLFVNSKVGAGVSTTSRKLVVVAAAAAPKKSWIPAVKGGGNFLDPEWLDGSLPGDFGFDPLGLGKDPA 96          
BLAST of FC920419 vs. ExPASy Swiss-Prot
Match: CB12_PETHY (Chlorophyll a-b binding protein, chloroplastic OS=Petunia hybrida PE=2 SV=1)

HSP 1 Score: 60.4622 bits (145), Expect = 1.676e-12
Identity = 28/56 (50.00%), Postives = 34/56 (60.71%), Query Frame = 1
Query:  286 GFDPLGLGKDPAFLKWYREAELIHGRWAMAAVVGIFVGQAWSGI------PWFEAG 435
            GFDPLGLG DP  LKW  +AEL+H RWAM    GIF+ +  + I       W+ AG
Sbjct:   87 GFDPLGLGSDPESLKWNAQAELVHSRWAMLGAAGIFIPEFLTKIGVLNTPSWYTAG 142          

HSP 2 Score: 32.7278 bits (73), Expect = 1.676e-12
Identity = 15/34 (44.12%), Postives = 17/34 (50.00%), Query Frame = 3
Query:  195 PPKKSWIPAVKGGGNLINPEWLDGSLPGDYRIRP 296
            P +  W P          PEWLDGSLPGD+   P
Sbjct:   63 PDRPLWFPGSTP------PEWLDGSLPGDFGFDP 90          
BLAST of FC920419 vs. ExPASy Swiss-Prot
Match: CB12_SOLLC (Chlorophyll a-b binding protein 7, chloroplastic OS=Solanum lycopersicum GN=CAB7 PE=3 SV=1)

HSP 1 Score: 56.9954 bits (136), Expect = 8.036e-12
Identity = 26/56 (46.43%), Postives = 34/56 (60.71%), Query Frame = 1
Query:  286 GFDPLGLGKDPAFLKWYREAELIHGRWAMAAVVGIFVGQAWSGI------PWFEAG 435
            GFDPLGL  DP  L+W ++AEL+H RWAM    GIF+ +  + I       W+ AG
Sbjct:   87 GFDPLGLASDPESLRWNQQAELVHCRWAMLGAAGIFIPELLTKIGILNTPSWYTAG 142          

HSP 2 Score: 33.8834 bits (76), Expect = 8.036e-12
Identity = 22/85 (25.88%), Postives = 35/85 (41.18%), Query Frame = 3
Query:   42 VEIISMAAATSGAVLNGLGSSFINGGKKSQALLAGTNRVTXXXXXXXXXXLPPKKSWIPAVKGGGNLINPEWLDGSLPGDYRIRP 296
            V   S ++  +G+++    +SF+ GG++ +     T               P +  W P          P WLDGSLPGD+   P
Sbjct:   13 VAFSSPSSRRNGSIVGTTKASFL-GGRRLRVSKYSTTPTARSATTVCVAADPDRPLWFPGSTP------PPWLDGSLPGDFGFDP 90          
The following BLAST results are available for this feature:
BLAST of FC920419 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 5
Match NameE-valueIdentityDescription
CB4B_SOLLC7.769e-3398.44Chlorophyll a-b binding protein CP24 10B, chloropl... [more]
CB4A_SOLLC1.731e-3296.88Chlorophyll a-b binding protein CP24 10A, chloropl... [more]
CB4_SPIOL1.914e-3192.19Chlorophyll a-b binding protein CP24, chloroplasti... [more]
CB12_PETHY1.676e-1250.00Chlorophyll a-b binding protein, chloroplastic OS=... [more]
CB12_SOLLC8.036e-1246.43Chlorophyll a-b binding protein 7, chloroplastic O... [more]
back to top
Properties
Property NameValue
Genbank descriptionC32008B06EF RVDevelop1 Citrus clementina cDNA clone C32008B06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920419 ID=FC920419|Name=FC920419|organism=Citrus clementina|type=EST|length=477bp
GAGTATTGATTGACAGCCCATTCTGCAGCTACAGAAGTCAAGTAGAGATC
ATATCTATGGCGGCTGCAACATCCGGGGCTGTGTTAAACGGATTGGGTTC
TTCATTCATAAATGGTGGCAAGAAGAGCCAGGCTCTTTTGGCTGGCACGA
ATAGAGTGACAAGTTCTAAAAAGTCAGTTGTTGTAGCTGCTCTTCCACCT
AAAAAATCTTGGATTCCTGCTGTTAAAGGTGGTGGCAACCTCATTAATCC
CGAATGGCTCGATGGCTCTCTCCCAGGTGACTACCGGATTCGACCCACTT
GGGCTTGGAAAGGACCCAGCATTCCTGAAATGGTACAGAGAAGCAGAACT
GATCCACGGACGATGGGCAATGGCTGCAGTTGTTGGGATATTCGTCGGAC
AGGCGTGGAGTGGGATTCCATGGTTCGAGGCTGGAGCAGATCCTGGAGCC
ATAGCACCCTTCTCCTTCGGCTCACTC
back to top