FC920421

Overview
NameFC920421
Unique NameFC920421
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length678
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
FC920421_ssr141 microsatellite FC920421_ssr141:141..158. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of FC920421 vs. ExPASy Swiss-Prot
Match: AAPC_CENCI (Putative glucose-6-phosphate 1-epimerase OS=Cenchrus ciliaris PE=2 SV=1)

HSP 1 Score: 260.381 bits (664), Expect = 6.345e-69
Identity = 119/159 (74.84%), Postives = 136/159 (85.53%), Query Frame = 3
Query:  201 EFCKGNNGLDKIVLRESRGSSAEVYLYGGHVTSWKNDHGEELLFVSSKATFKPPKAIRGGIPICFPQFASHGSLESHGFARNRFWSIDTDPPAFPTNSSSKAYIDLILRPSEEDLKIWPHSFEFRLRVALTPGGDLMLISRVRNTSTDGKPFSFTFAYH 677
            E  K  +GL+K+VLR +R   AE+YLYGG VTSWKND+GEELLF+SSKA FKPPKAIRGGIPIC PQF +HG+LE HGFARNRFWSID DPP  P N + KA++DLILRP+EEDLKIWPHSFEFRLRVAL P GDL L SR+RNT+TDG+PFS+TFAYH
Sbjct:   25 ELVKTPSGLEKVVLRGARNCCAEIYLYGGQVTSWKNDNGEELLFLSSKAIFKPPKAIRGGIPICLPQFGTHGNLEQHGFARNRFWSIDNDPPPLPVNPAIKAFVDLILRPAEEDLKIWPHSFEFRLRVALGPSGDLSLTSRIRNTNTDGRPFSYTFAYH 183          
BLAST of FC920421 vs. ExPASy Swiss-Prot
Match: YEAD_ECOLI (Putative glucose-6-phosphate 1-epimerase OS=Escherichia coli (strain K12) GN=yeaD PE=1 SV=2)

HSP 1 Score: 75.485 bits (184), Expect = 2.895e-13
Identity = 48/136 (35.29%), Postives = 69/136 (50.74%), Query Frame = 3
Query:  165 FKIMSTEKFLPVEFCKGNNGLDKIVLRESRGSSAEVYLYGGHVTSWKNDHGEELLFVSSKATFKPPKAIRGGIPICFPQF--ASHGSLESHGFARNRFWSIDTDPPAFPTNSSSKAYIDLILRPSEEDLKIWPHSF 566
            F +   E+  PV   +  + LD IV+   +   A   L G H+ SWK    EE+L++S+   FK   AIRGG+P+C+P F  A+   L +HGFARN  W++ +         +    +   L  SEE  K WPH F
Sbjct:    6 FALPVIEQISPVLSRRKLDELDLIVVDHPQ-VKASFALQGAHLLSWKPAGEEEVLWLSNNTPFKNGVAIRGGVPVCWPWFGPAAQQGLPAHGFARNLPWTLKSH-----HEDADGVALTFELTQSEETKKFWPHDF 135          
The following BLAST results are available for this feature:
BLAST of FC920421 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
AAPC_CENCI6.345e-6974.84Putative glucose-6-phosphate 1-epimerase OS=Cenchr... [more]
YEAD_ECOLI2.895e-1335.29Putative glucose-6-phosphate 1-epimerase OS=Escher... [more]
back to top
Properties
Property NameValue
Genbank descriptionC32008B08EF RVDevelop1 Citrus clementina cDNA clone C32008B08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920421 ID=FC920421|Name=FC920421|organism=Citrus clementina|type=EST|length=678bp
GAACGGAGAGAAGAAGTGAGAAGCAGAAAAGAACGAAATATCTCTCGCTC
TACTGAAGTGAGCTAACACTAAGTGAGAGAGATTTCATTTTCATATCGAA
TGCTGTGAATTTTCACATCAAACGAAGAGTAGAAAATCTTGGCGGCGGCG
GCGGCGGCAGCGGCTTCAAAATCATGTCGACGGAGAAGTTTCTTCCAGTT
GAGTTCTGCAAGGGCAATAACGGCCTCGACAAGATCGTTCTCCGCGAGTC
ACGCGGCAGCTCCGCTGAGGTGTATTTGTACGGGGGTCATGTGACGTCTT
GGAAGAATGATCATGGAGAGGAATTGCTTTTTGTCAGTAGTAAGGCTACA
TTCAAGCCTCCCAAAGCGATTCGCGGAGGAATTCCAATCTGCTTTCCTCA
GTTTGCAAGTCATGGCTCTCTGGAGTCGCATGGGTTTGCTAGAAATCGGT
TTTGGAGTATTGACACTGACCCGCCTGCTTTTCCAACTAATTCCTCGAGT
AAGGCTTATATTGATTTGATACTAAGGCCCTCGGAAGAAGATCTGAAGAT
CTGGCCTCACAGTTTTGAGTTCCGTCTCAGGGTAGCTTTGACTCCTGGTG
GTGATCTGATGTTGATCTCTCGCGTTAGGAATACTAGCACTGATGGAAAG
CCATTTTCGTTCACATTTGCATATCATA
back to top