FC920474

Overview
NameFC920474
Unique NameFC920474
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length678
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10260 contig Ccv1_Contig10260:6..683. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920474 vs. ExPASy Swiss-Prot
Match: CHS2_CITSI (Chalcone synthase 2 OS=Citrus sinensis GN=CHS2 PE=2 SV=1)

HSP 1 Score: 420.239 bits (1079), Expect = 4.791e-117
Identity = 208/208 (100.00%), Postives = 208/208 (100.00%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDS 676
            MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDS
Sbjct:    1 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDS 208          
BLAST of FC920474 vs. ExPASy Swiss-Prot
Match: CHS2_RUTGR (Chalcone synthase 2 OS=Ruta graveolens GN=CHS2 PE=2 SV=1)

HSP 1 Score: 396.356 bits (1017), Expect = 7.409e-110
Identity = 194/206 (94.17%), Postives = 200/206 (97.09%), Query Frame = 2
Query:   59 TVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDS 676
            TV+EIR AQRADGPA VLAIGTATPA+ V QADYPDYYFRITKSEHMTELKEKFKRMCDKSMI+KRYMYLTE+ILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAA KAIKEWGQPKSKITHLIFCTTSGVDMPG DYQLTKL+GLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN+GARVLVVCSEITAVTFRGPADTHLDS
Sbjct:    5 TVEEIRKAQRADGPAAVLAIGTATPANYVTQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIRKRYMYLTEDILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQPKSKITHLIFCTTSGVDMPGCDYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNRGARVLVVCSEITAVTFRGPADTHLDS 210          
BLAST of FC920474 vs. ExPASy Swiss-Prot
Match: CHS3_RUTGR (Chalcone synthase 3 OS=Ruta graveolens GN=CHS3 PE=2 SV=1)

HSP 1 Score: 394.815 bits (1013), Expect = 2.156e-109
Identity = 193/206 (93.69%), Postives = 200/206 (97.09%), Query Frame = 2
Query:   59 TVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDS 676
            TV+EIR AQRADGPATVLAIGTATPA+ V QADYPDYYFRITKSEHMT+LKEKFKRMCDKSMI+KRYM+LTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAA KAIKEWGQPKSKITHLIFCTTSGVDMPG DYQLTKL+GLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN+GARVLVVCSEITAVTFRGP DTHLDS
Sbjct:    5 TVEEIRKAQRADGPATVLAIGTATPANYVTQADYPDYYFRITKSEHMTDLKEKFKRMCDKSMIRKRYMHLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAAKAIKEWGQPKSKITHLIFCTTSGVDMPGCDYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNRGARVLVVCSEITAVTFRGPVDTHLDS 210          
BLAST of FC920474 vs. ExPASy Swiss-Prot
Match: CHS1_RUTGR (Chalcone synthase 1 OS=Ruta graveolens GN=CHS1 PE=2 SV=1)

HSP 1 Score: 392.119 bits (1006), Expect = 1.397e-108
Identity = 192/206 (93.20%), Postives = 199/206 (96.60%), Query Frame = 2
Query:   59 TVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDS 676
            TV+ IR AQRADGPA VLAIGTATPA+ V QADYPDYYFRITKSEHMTELKEKFKRMCDKSMI+KRYM+LTE+ILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAA KAIKEWGQPKSKITHLIFCTTSGVDMPG DYQLTKL+GLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN+GARVLVVCSEITAVTFRGPADTHLDS
Sbjct:    5 TVEAIRKAQRADGPAAVLAIGTATPANYVTQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIRKRYMHLTEDILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQPKSKITHLIFCTTSGVDMPGCDYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNRGARVLVVCSEITAVTFRGPADTHLDS 210          
BLAST of FC920474 vs. ExPASy Swiss-Prot
Match: CHSY_BETVE (Chalcone synthase OS=Betula verrucosa GN=CHS PE=2 SV=2)

HSP 1 Score: 391.349 bits (1004), Expect = 2.383e-108
Identity = 191/208 (91.83%), Postives = 199/208 (95.67%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDS 676
            MA+V+EIR AQRA GPATVLAIGTATP++ + QADYPDYYFRITKS+HMTELKEKFKRMCDKSMIKKRYMYL EEIL ENPNMCAYMAPSLDARQ IVVVEVPKLGKEAATKAIKEWGQPKSKITHL+FCTTSGVDMPGADYQLTKL+GLRPSVKR MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGP DTHLDS
Sbjct:    1 MASVEEIRKAQRAHGPATVLAIGTATPSNCITQADYPDYYFRITKSDHMTELKEKFKRMCDKSMIKKRYMYLNEEILNENPNMCAYMAPSLDARQTIVVVEVPKLGKEAATKAIKEWGQPKSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPTDTHLDS 208          
BLAST of FC920474 vs. ExPASy Swiss-Prot
Match: CHS3_SOYBN (Chalcone synthase 3 OS=Glycine max GN=CHS3 PE=3 SV=1)

HSP 1 Score: 389.423 bits (999), Expect = 9.057e-108
Identity = 189/208 (90.87%), Postives = 201/208 (96.63%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDS 676
            M +V+EIRNAQRA+GPATV+AIGTATP + V+Q+ YPDYYFRIT SEHMTELKEKFKRMCDKSMIKKRYMYL EEILKENP++CAYMAPSLDARQD+VVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GLRPSVKR+MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGP DTHLDS
Sbjct:    1 MVSVEEIRNAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHMTELKEKFKRMCDKSMIKKRYMYLNEEILKENPSVCAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPSVKRYMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPTDTHLDS 208          
BLAST of FC920474 vs. ExPASy Swiss-Prot
Match: CHS1_SOYBN (Chalcone synthase 1 OS=Glycine max GN=CHS1 PE=3 SV=1)

HSP 1 Score: 387.111 bits (993), Expect = 4.495e-107
Identity = 188/208 (90.38%), Postives = 200/208 (96.15%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDS 676
            M +V+EIR AQRA+GPATV+AIGTATP + V+Q+ YPDYYFRIT SEHMTELKEKFKRMCDKSMIKKRYMYL EEILKENP++CAYMAPSLDARQD+VVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GLRPSVKR+MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGP DTHLDS
Sbjct:    1 MVSVEEIRKAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHMTELKEKFKRMCDKSMIKKRYMYLNEEILKENPSVCAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPSVKRYMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPTDTHLDS 208          
BLAST of FC920474 vs. ExPASy Swiss-Prot
Match: CHS5_SOYBN (Chalcone synthase 5 OS=Glycine max GN=CHS5 PE=3 SV=1)

HSP 1 Score: 385.956 bits (990), Expect = 1.001e-106
Identity = 187/208 (89.90%), Postives = 200/208 (96.15%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDS 676
            M +V+EIR AQRA+GPATV+AIGTATP + V+Q+ YPDYYFRIT SEHMTELKEKFKRMCDKSMIKKRYMYL EEILKENP++CAYMAPSLDARQD+VV+EVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GLRPSVKR+MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGP DTHLDS
Sbjct:    1 MVSVEEIRQAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHMTELKEKFKRMCDKSMIKKRYMYLNEEILKENPSVCAYMAPSLDARQDMVVMEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPSVKRYMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPTDTHLDS 208          
BLAST of FC920474 vs. ExPASy Swiss-Prot
Match: CHS2_SOYBN (Chalcone synthase 2 OS=Glycine max GN=CHS2 PE=3 SV=1)

HSP 1 Score: 385.956 bits (990), Expect = 1.001e-106
Identity = 187/208 (89.90%), Postives = 200/208 (96.15%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDS 676
            M +V+EIR AQRA+GPATV+AIGTATP + V+Q+ YPDYYFRIT SEHMTELKEKFKRMCDKSMIKKRYMYL EEILKENP++CAYMAPSLDARQD+VV+EVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GLRPSVKR+MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGP DTHLDS
Sbjct:    1 MVSVEEIRKAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHMTELKEKFKRMCDKSMIKKRYMYLNEEILKENPSVCAYMAPSLDARQDMVVMEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPSVKRYMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPTDTHLDS 208          
BLAST of FC920474 vs. ExPASy Swiss-Prot
Match: CHS2_CAMSI (Chalcone synthase 2 OS=Camellia sinensis GN=CHS2 PE=2 SV=1)

HSP 1 Score: 385.185 bits (988), Expect = 1.708e-106
Identity = 186/208 (89.42%), Postives = 199/208 (95.67%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDS 676
            M TV+E+R AQRA+GPATV+AIGTATP + V+Q+ YPDYYFRIT SEH TELKEKF+RMCDKSMIKKRYMYLTEEILKENPN+CAYMAPSLDARQD+VVVEVPKLGKEAATKAIKEWGQPKSKITHL+FCTTSGVDMPGADYQLTKL+GLRPSVKR MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGP+D HLDS
Sbjct:    1 MVTVEEVRRAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHKTELKEKFQRMCDKSMIKKRYMYLTEEILKENPNVCAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPSDAHLDS 208          
The following BLAST results are available for this feature:
BLAST of FC920474 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 145
Match NameE-valueIdentityDescription
CHS2_CITSI4.791e-117100.00Chalcone synthase 2 OS=Citrus sinensis GN=CHS2 PE=... [more]
CHS2_RUTGR7.409e-11094.17Chalcone synthase 2 OS=Ruta graveolens GN=CHS2 PE=... [more]
CHS3_RUTGR2.156e-10993.69Chalcone synthase 3 OS=Ruta graveolens GN=CHS3 PE=... [more]
CHS1_RUTGR1.397e-10893.20Chalcone synthase 1 OS=Ruta graveolens GN=CHS1 PE=... [more]
CHSY_BETVE2.383e-10891.83Chalcone synthase OS=Betula verrucosa GN=CHS PE=2 ... [more]
CHS3_SOYBN9.057e-10890.87Chalcone synthase 3 OS=Glycine max GN=CHS3 PE=3 SV... [more]
CHS1_SOYBN4.495e-10790.38Chalcone synthase 1 OS=Glycine max GN=CHS1 PE=3 SV... [more]
CHS5_SOYBN1.001e-10689.90Chalcone synthase 5 OS=Glycine max GN=CHS5 PE=3 SV... [more]
CHS2_SOYBN1.001e-10689.90Chalcone synthase 2 OS=Glycine max GN=CHS2 PE=3 SV... [more]
CHS2_CAMSI1.708e-10689.42Chalcone synthase 2 OS=Camellia sinensis GN=CHS2 P... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32008H02EF RVDevelop1 Citrus clementina cDNA clone C32008H02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920474 ID=FC920474|Name=FC920474|organism=Citrus clementina|type=EST|length=678bp
AGAACTCACCAAGCACGAGCCACAAACATATTCATTAAGGGTTCAACTTG
AAATGGCAACCGTTCAAGAGATCAGAAACGCTCAGCGTGCCGACGGCCCG
GCCACCGTCCTCGCCATCGGTACGGCCACGCCTGCCCACAGTGTCAACCA
GGCTGATTATCCCGACTATTACTTCAGGATCACAAAGAGCGAGCATATGA
CGGAGCTTAAAGAGAAGTTCAAGCGCATGTGTGACAAGTCGATGATTAAG
AAGCGTTACATGTACTTAACGGAAGAGATTTTGAAGGAAAACCCCAACAT
GTGCGCTTACATGGCTCCATCACTCGACGCACGTCAAGACATTGTGGTGG
TCGAAGTGCCGAAGCTCGGGAAAGAAGCTGCTACAAAGGCCATCAAAGAA
TGGGGCCAGCCCAAGTCTAAGATCACCCACCTCATCTTCTGCACCACCTC
CGGCGTCGACATGCCCGGCGCCGACTACCAGCTCACCAAACTGATCGGCC
TGCGCCCCTCCGTCAAGCGCTTCATGATGTACCAACAAGGATGTTTCGCC
GGCGGCACTGTTCTTCGCCTCGCTAAAGACTTGGCTGAGAACAACAAGGG
CGCTCGCGTTCTTGTTGTCTGTTCGGAGATCACGGCAGTCACTTTCCGCG
GCCCTGCCGATACTCATCTTGATTCTCT
back to top