FC920476

Overview
NameFC920476
Unique NameFC920476
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length753
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
FC920476_ssr40 microsatellite FC920476_ssr40:40..51. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig9360 contig Ccv1_Contig9360:1..753. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920476 vs. ExPASy Swiss-Prot
Match: CB26_ARATH (Chlorophyll a-b binding protein CP26, chloroplastic OS=Arabidopsis thaliana GN=LHCB5 PE=2 SV=1)

HSP 1 Score: 296.59 bits (758), Expect = 9.732e-80
Identity = 151/213 (70.89%), Postives = 169/213 (79.34%), Query Frame = 1
Query:  103 IGVKEMLGNPLNVSSAVRTSAPGASNPSTFKPVALFXXXXXXXXXXXXXXXXXXXNEELAKWYGPDRRIFLPEGLLDRSEIPEYLTGEVPGDYGYDPFGLSKKPDDFSKYQAYELIHARWAMLGAAGFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFGKNIPINLVFAVIAEIVLVGGAEYYRITT-VWIGGQAHP-VVI*PLGLAR 735
            +GV EMLG PLN  +  R+SAP AS+PSTFK VALF                   ++ELAKWYGPDRRIFLP+GLLDRSEIPEYL GEV GDYGYDPFGL KKP++F+KYQA+ELIHARWAMLGAAGFIIPEA NK+GANCGPEAVWFKTGALLLDGNTLNYFGKNIPINLV AV+AE+VL+GGAEYYRIT  +    + HP     PLGLA+
Sbjct:    4 LGVSEMLGTPLNFRAVSRSSAPLASSPSTFKTVALFSKKKPAPAKSKAVSET---SDELAKWYGPDRRIFLPDGLLDRSEIPEYLNGEVAGDYGYDPFGLGKKPENFAKYQAFELIHARWAMLGAAGFIIPEALNKYGANCGPEAVWFKTGALLLDGNTLNYFGKNIPINLVLAVVAEVVLLGGAEYYRITNGLDFEDKLHPGGPFDPLGLAK 213          
BLAST of FC920476 vs. ExPASy Swiss-Prot
Match: CB2_DUNTE (Chlorophyll a-b binding protein of LHCII type I, chloroplastic OS=Dunaliella tertiolecta PE=2 SV=1)

HSP 1 Score: 117.857 bits (294), Expect = 6.195e-26
Identity = 68/164 (41.46%), Postives = 92/164 (56.10%), Query Frame = 1
Query:  283 KWYGPDRRIFLPEGLLDRSEIPEYLTGEVPGDYGYDPFGLSKKPDDFSKYQAYELIHARWAMLGAAGFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFGKNIPI---NLVFAVIAEIVLVGGAEYYR-----------ITTVWIGGQAHPVVI*PLGLA 732
            ++YGPDR  FL  G    ++ PEYLTGE PGDYG+D  GLS  P  F++Y+  ELIHARWA+LGA G + PE  +++      E VWFK GA +     LNY G    I   +++  +  ++VL+G AE YR           + T++ GG        PLGLA
Sbjct:   32 EFYGPDRAKFL--GPFSENDTPEYLTGEFPGDYGWDTAGLSADPQTFARYREIELIHARWALLGALGILTPELLSQYAGVQFGEPVWFKAGAQIFADGGLNYLGNESLIHAQSIIATLAVQVVLMGLAEAYRANGGSEGFLDDLDTLYPGGPFD-----PLGLA 188          
BLAST of FC920476 vs. ExPASy Swiss-Prot
Match: CB2B_PINSY (Chlorophyll a-b binding protein type 2 member 1B, chloroplastic OS=Pinus sylvestris PE=2 SV=1)

HSP 1 Score: 114.775 bits (286), Expect = 5.245e-25
Identity = 67/156 (42.95%), Postives = 88/156 (56.41%), Query Frame = 1
Query:  286 WYGPDRRIFLPEGLLDRSEIPEYLTGEVPGDYGYDPFGLSKKPDDFSKYQAYELIHARWAMLGAAGFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFGKN--IPINLVFAVIA-EIVLVGGAEYYRITTVWIGGQAHPVV----I*PLGLA 732
            WYGPDR ++L        E P YLTGE PGDYG+D  GLS  P++F+K +  E+IH RWAMLGA G + PE   + G   G EAVWFK GA +     L+Y G    +    + A+ A +++L+G  E YRI    +G    P+       PLGLA
Sbjct:   58 WYGPDRVLYLGPF---SGEPPSYLTGEFPGDYGWDTAGLSADPENFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFG-EAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLA 209          
BLAST of FC920476 vs. ExPASy Swiss-Prot
Match: CB2A_PINSY (Chlorophyll a-b binding protein type 2 member 1A, chloroplastic OS=Pinus sylvestris PE=2 SV=1)

HSP 1 Score: 114.005 bits (284), Expect = 8.946e-25
Identity = 67/156 (42.95%), Postives = 89/156 (57.05%), Query Frame = 1
Query:  286 WYGPDRRIFLPEGLLDRSEIPEYLTGEVPGDYGYDPFGLSKKPDDFSKYQAYELIHARWAMLGAAGFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFG--KNIPINLVFAVIA-EIVLVGGAEYYRITTVWIGGQAHPVV----I*PLGLA 732
            WYGPDR ++L        E P YLTGE PGDYG+D  GLS  P+ F+K +  E+IH+RWAMLGA G + PE   + G   G EAVWFK GA +     L+Y G  + I    + A+ A +++L+G  E YR+    +G    P+       PLGLA
Sbjct:   62 WYGPDRVLYLGPF---SGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFG-EAVWFKAGAQIFSEGGLDYLGSPQLIHAQSILAIWACQVILMGAIEGYRVAGGPLGEVTDPIYPGGNFDPLGLA 213          
BLAST of FC920476 vs. ExPASy Swiss-Prot
Match: CB29_MAIZE (Chlorophyll a-b binding protein M9, chloroplastic OS=Zea mays GN=CAB-M9 PE=2 SV=1)

HSP 1 Score: 114.005 bits (284), Expect = 8.946e-25
Identity = 69/156 (44.23%), Postives = 90/156 (57.69%), Query Frame = 1
Query:  286 WYGPDRRIFLPEGLLDRSEIPEYLTGEVPGDYGYDPFGLSKKPDDFSKYQAYELIHARWAMLGAAGFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFGKN--IPINLVFAVIA-EIVLVGGAEYYRITTVWIGGQAHPV----VI*PLGLA 732
            WYGPDR ++L  G L   E P YLTGE PGDYG+D  GLS  P+ F+K +  E+IH+RWAMLGA G + PE   + G   G EAVWFK G+ +     L+Y G    I    + A+ A ++VL+G  E YR+    +G    P+       PLGLA
Sbjct:   49 WYGPDRVLYL--GPLS-GEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFG-EAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAIEGYRVAGGPLGEVVDPLYPGGTFDPLGLA 200          
BLAST of FC920476 vs. ExPASy Swiss-Prot
Match: CB22_MAIZE (Chlorophyll a-b binding protein, chloroplastic OS=Zea mays PE=2 SV=1)

HSP 1 Score: 114.005 bits (284), Expect = 8.946e-25
Identity = 70/156 (44.87%), Postives = 89/156 (57.05%), Query Frame = 1
Query:  286 WYGPDRRIFLPEGLLDRSEIPEYLTGEVPGDYGYDPFGLSKKPDDFSKYQAYELIHARWAMLGAAGFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFGKN--IPINLVFAVIA-EIVLVGGAEYYRITTVWIGGQAHPVV----I*PLGLA 732
            WYGPDR ++L  G L   E P YLTGE PGDYG+D  GLS  P+ F+K +  E+IH RWAMLGA G + PE   + G   G EAVWFK G+ +     L+Y G    I    + A+ A ++VL+G  E YRI    +G    P+       PLGLA
Sbjct:   49 WYGPDRVLYL--GPLS-GEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFG-EAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLA 200          
BLAST of FC920476 vs. ExPASy Swiss-Prot
Match: CB2A_PYRPY (Chlorophyll a-b binding protein 1A, chloroplastic OS=Pyrus pyrifolia PE=2 SV=1)

HSP 1 Score: 113.62 bits (283), Expect = 1.168e-24
Identity = 67/156 (42.95%), Postives = 89/156 (57.05%), Query Frame = 1
Query:  286 WYGPDRRIFLPEGLLDRSEIPEYLTGEVPGDYGYDPFGLSKKPDDFSKYQAYELIHARWAMLGAAGFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFG--KNIPINLVFAVIA-EIVLVGGAEYYRITTVWIGGQAHPVV----I*PLGLA 732
            WYGPDR ++L        E P YLTGE PGDYG+D  GLS  P+ F+K +  E+IH+RWAMLGA G + PE   + G   G EAVWFK GA +     L+Y G  + I    + A+ A +++L+G  E YR+    +G    P+       PLGLA
Sbjct:   62 WYGPDRVMYLGPF---SGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFG-EAVWFKAGAQIFSEGGLDYLGSPQLIHAQSILAIWACQVILMGAIEGYRVAGGPLGEVTDPIYPGGNFDPLGLA 213          
BLAST of FC920476 vs. ExPASy Swiss-Prot
Match: CB21_GOSHI (Chlorophyll a-b binding protein 151, chloroplastic OS=Gossypium hirsutum GN=CAB-151 PE=2 SV=2)

HSP 1 Score: 113.62 bits (283), Expect = 1.168e-24
Identity = 68/156 (43.59%), Postives = 88/156 (56.41%), Query Frame = 1
Query:  286 WYGPDRRIFLPEGLLDRSEIPEYLTGEVPGDYGYDPFGLSKKPDDFSKYQAYELIHARWAMLGAAGFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFGKN--IPINLVFAVIA-EIVLVGGAEYYRITTVWIGGQAHPV----VI*PLGLA 732
            WYGPDR  +L        +IP YLTGE PGDYG+D  GLS  P+ F+K +  E+IH RWAMLGA G + PE  +K G   G EAVWFK G+ +     L+Y G    I    + A+ A ++VL+G  E YR+    +G    P+       PLGLA
Sbjct:   49 WYGPDRPKYLGPF---SDQIPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEILSKNGVKFG-EAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRVGGGPLGEGLDPIYPGGAFDPLGLA 200          
BLAST of FC920476 vs. ExPASy Swiss-Prot
Match: CB28_PEA (Chlorophyll a-b binding protein 8, chloroplastic OS=Pisum sativum GN=CAB8 PE=1 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 1.526e-24
Identity = 67/156 (42.95%), Postives = 88/156 (56.41%), Query Frame = 1
Query:  286 WYGPDRRIFLPEGLLDRSEIPEYLTGEVPGDYGYDPFGLSKKPDDFSKYQAYELIHARWAMLGAAGFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFGKN--IPINLVFAVIA-EIVLVGGAEYYRITTVWIGGQAHPVV----I*PLGLA 732
            WYGPDR  +L        E P YLTGE PGDYG+D  GLS  P+ FSK +  E+IH+RWAMLGA G + PE  ++ G   G EAVWFK G+ +     L+Y G    +    + A+ A +++L+G  E YRI    +G    P+       PLGLA
Sbjct:   52 WYGPDRVKYLGPF---SGESPSYLTGEFPGDYGWDTAGLSADPETFSKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFG-EAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLA 203          
BLAST of FC920476 vs. ExPASy Swiss-Prot
Match: CB22_PEA (Chlorophyll a-b binding protein AB80, chloroplastic OS=Pisum sativum GN=AB80 PE=1 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 1.526e-24
Identity = 67/156 (42.95%), Postives = 88/156 (56.41%), Query Frame = 1
Query:  286 WYGPDRRIFLPEGLLDRSEIPEYLTGEVPGDYGYDPFGLSKKPDDFSKYQAYELIHARWAMLGAAGFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFGKN--IPINLVFAVIA-EIVLVGGAEYYRITTVWIGGQAHPVV----I*PLGLA 732
            WYGPDR  +L        E P YLTGE PGDYG+D  GLS  P+ FSK +  E+IH+RWAMLGA G + PE  ++ G   G EAVWFK G+ +     L+Y G    +    + A+ A +++L+G  E YRI    +G    P+       PLGLA
Sbjct:   53 WYGPDRVKYLGPF---SGESPSYLTGEFPGDYGWDTAGLSADPETFSKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFG-EAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLA 204          
The following BLAST results are available for this feature:
BLAST of FC920476 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 64
Match NameE-valueIdentityDescription
CB26_ARATH9.732e-8070.89Chlorophyll a-b binding protein CP26, chloroplasti... [more]
CB2_DUNTE6.195e-2641.46Chlorophyll a-b binding protein of LHCII type I, c... [more]
CB2B_PINSY5.245e-2542.95Chlorophyll a-b binding protein type 2 member 1B, ... [more]
CB2A_PINSY8.946e-2542.95Chlorophyll a-b binding protein type 2 member 1A, ... [more]
CB29_MAIZE8.946e-2544.23Chlorophyll a-b binding protein M9, chloroplastic ... [more]
CB22_MAIZE8.946e-2544.87Chlorophyll a-b binding protein, chloroplastic OS=... [more]
CB2A_PYRPY1.168e-2442.95Chlorophyll a-b binding protein 1A, chloroplastic ... [more]
CB21_GOSHI1.168e-2443.59Chlorophyll a-b binding protein 151, chloroplastic... [more]
CB28_PEA1.526e-2442.95Chlorophyll a-b binding protein 8, chloroplastic O... [more]
CB22_PEA1.526e-2442.95Chlorophyll a-b binding protein AB80, chloroplasti... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32008H04EF RVDevelop1 Citrus clementina cDNA clone C32008H04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920476 ID=FC920476|Name=FC920476|organism=Citrus clementina|type=EST|length=753bp
GACTCTCATCTTCACCATTTCATTTCTCTAACACAAAGAAGCAGCAGCAG
CAACACTCTGAAGATGGCTTCATTGGCAGCATCGTCCACTCCTGCTGCCT
CCATTGGAGTTAAGGAGATGCTTGGCAACCCTCTCAATGTCAGCAGTGCT
GTTAGGACTTCAGCTCCAGGTGCATCAAACCCTTCTACTTTCAAGCCCGT
TGCTCTCTTCTCCAAGAAGAAAGCCGCCCCTCCTGCCAAGTCTAAGCCCG
TCGCCGTCTCCCCCGTTAACGAAGAGCTCGCCAAGTGGTATGGTCCTGAC
CGAAGAATTTTCTTGCCCGAGGGTCTCTTGGACAGATCTGAGATCCCTGA
GTACTTGACCGGAGAAGTTCCCGGAGACTATGGTTACGATCCTTTTGGTC
TCAGCAAGAAACCAGACGACTTCAGCAAATATCAGGCATATGAATTGATT
CATGCCAGATGGGCCATGCTTGGTGCTGCTGGTTTCATCATTCCTGAAGC
CTTTAACAAGTTTGGTGCTAACTGTGGTCCTGAAGCTGTCTGGTTCAAGA
CTGGAGCTCTACTTCTTGATGGAAACACATTGAACTACTTCGGAAAGAAC
ATCCCAATCAACCTTGTTTTTGCTGTCATTGCTGAGATTGTTCTTGTAGG
TGGTGCTGAATATTATAGAATCACCACGGTTTGGATTGGAGGACAAGCTC
ACCCAGTGGTCATTTGACCACTGGGATTAGCAAGATCTGACCATTGCATG
CTA
back to top