FC920482

Overview
NameFC920482
Unique NameFC920482
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length726
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig952 contig Ccv1_Contig952:6..731. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920482 vs. ExPASy Swiss-Prot
Match: INO1_CITPA (Inositol-3-phosphate synthase OS=Citrus paradisi PE=3 SV=1)

HSP 1 Score: 308.916 bits (790), Expect = 1.757e-83
Identity = 148/152 (97.37%), Postives = 149/152 (98.03%), Query Frame = 3
Query:  270 MFIENFKVESPNVKYTDNEIHSVYDYETTELVHENRNGTYQWIVKPKTVKYEFKTDVHVPKLGVMLVGWGGNNGSTLTGGVIANREGISWATKDTVQQANYFGSLTQASAIRVGSYNGEEIYAPFKSILPMVNPDDIVLXGWDISDMNLADA 725
            MFIENFKVESPNVKYTD+EIHSVYDYETTELVHENRNGTYQWIVKPKTVKYEFKTDVHVPKLGVMLVGWGGNNGSTLTGGVIANREGI WATKDTVQQANYFGSLTQASAIRVGSYNGEEIYAPFKSILPMVNPDDIV  GWDISDMNLADA
Sbjct:    1 MFIENFKVESPNVKYTDHEIHSVYDYETTELVHENRNGTYQWIVKPKTVKYEFKTDVHVPKLGVMLVGWGGNNGSTLTGGVIANREGICWATKDTVQQANYFGSLTQASAIRVGSYNGEEIYAPFKSILPMVNPDDIVFGGWDISDMNLADA 152          
BLAST of FC920482 vs. ExPASy Swiss-Prot
Match: INO1_NICPA (Inositol-3-phosphate synthase OS=Nicotiana paniculata GN=INPS1 PE=2 SV=1)

HSP 1 Score: 295.049 bits (754), Expect = 2.625e-79
Identity = 138/152 (90.79%), Postives = 146/152 (96.05%), Query Frame = 3
Query:  270 MFIENFKVESPNVKYTDNEIHSVYDYETTELVHENRNGTYQWIVKPKTVKYEFKTDVHVPKLGVMLVGWGGNNGSTLTGGVIANREGISWATKDTVQQANYFGSLTQASAIRVGSYNGEEIYAPFKSILPMVNPDDIVLXGWDISDMNLADA 725
            MFIENFKVESPNVKYT++EIHSVYDY+TTELVH+ +NGTYQW VKPKTVKYEFKTDVHVPKLGVMLVGWGGNNGSTLTGGVIANREGISWATKD VQQANYFGSLTQAS IRVGS+NGEEIYAPFKS+LPMVNPDD+V  GWDISDMNLADA
Sbjct:    1 MFIENFKVESPNVKYTESEIHSVYDYQTTELVHDEKNGTYQWTVKPKTVKYEFKTDVHVPKLGVMLVGWGGNNGSTLTGGVIANREGISWATKDKVQQANYFGSLTQASTIRVGSFNGEEIYAPFKSLLPMVNPDDVVFGGWDISDMNLADA 152          
BLAST of FC920482 vs. ExPASy Swiss-Prot
Match: INO1_WHEAT (Inositol-3-phosphate synthase OS=Triticum aestivum GN=MIPS PE=2 SV=1)

HSP 1 Score: 293.893 bits (751), Expect = 5.848e-79
Identity = 137/152 (90.13%), Postives = 146/152 (96.05%), Query Frame = 3
Query:  270 MFIENFKVESPNVKYTDNEIHSVYDYETTELVHENRNGTYQWIVKPKTVKYEFKTDVHVPKLGVMLVGWGGNNGSTLTGGVIANREGISWATKDTVQQANYFGSLTQASAIRVGSYNGEEIYAPFKSILPMVNPDDIVLXGWDISDMNLADA 725
            MFIE+FKVESPNVKYT+NEIHSVYDYETTE+VHENRNGTYQW+VKPKTVKY+FKTD  VPKLGVMLVGWGGNNGSTLT GVIAN+EGISWATKD VQQANYFGSLTQAS+IRVGSYNGEEIYAPFKS+LPMVNPDD+V  GWDISDMNLADA
Sbjct:    1 MFIESFKVESPNVKYTENEIHSVYDYETTEVVHENRNGTYQWVVKPKTVKYDFKTDTRVPKLGVMLVGWGGNNGSTLTAGVIANKEGISWATKDKVQQANYFGSLTQASSIRVGSYNGEEIYAPFKSLLPMVNPDDVVFGGWDISDMNLADA 152          
BLAST of FC920482 vs. ExPASy Swiss-Prot
Match: INO1_TOBAC (Inositol-3-phosphate synthase OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 293.508 bits (750), Expect = 7.637e-79
Identity = 138/152 (90.79%), Postives = 145/152 (95.39%), Query Frame = 3
Query:  270 MFIENFKVESPNVKYTDNEIHSVYDYETTELVHENRNGTYQWIVKPKTVKYEFKTDVHVPKLGVMLVGWGGNNGSTLTGGVIANREGISWATKDTVQQANYFGSLTQASAIRVGSYNGEEIYAPFKSILPMVNPDDIVLXGWDISDMNLADA 725
            MFIENFKVESPNVKYT++EIHSVYDY+TTELVHE +NGTYQW VKPKTVKYEFKTDVHVPKLGVMLVGWGGNNGSTLTGGVIANREGISWATKD VQQANYFGSLTQAS IRVGS+NGEEIYAPFKS+LPMVNPDD+V  GWDIS MNLADA
Sbjct:    1 MFIENFKVESPNVKYTESEIHSVYDYQTTELVHEEKNGTYQWTVKPKTVKYEFKTDVHVPKLGVMLVGWGGNNGSTLTGGVIANREGISWATKDKVQQANYFGSLTQASTIRVGSFNGEEIYAPFKSLLPMVNPDDVVFGGWDISGMNLADA 152          
BLAST of FC920482 vs. ExPASy Swiss-Prot
Match: INO1_SESIN (Inositol-3-phosphate synthase OS=Sesamum indicum PE=2 SV=1)

HSP 1 Score: 293.508 bits (750), Expect = 7.637e-79
Identity = 138/152 (90.79%), Postives = 147/152 (96.71%), Query Frame = 3
Query:  270 MFIENFKVESPNVKYTDNEIHSVYDYETTELVHENRNGTYQWIVKPKTVKYEFKTDVHVPKLGVMLVGWGGNNGSTLTGGVIANREGISWATKDTVQQANYFGSLTQASAIRVGSYNGEEIYAPFKSILPMVNPDDIVLXGWDISDMNLADA 725
            MFIE+FKVESPNVKYT+ EIHSVY+YETTELVHE+RNGTYQWIVKPKTVKYEFKTD HVPKLGVMLVGWGGNNGSTLTGGVIANREGISWATKD VQQANYFGSLTQAS+IRVGS+NGEEIYAPFKS+LPMVNPDD+V  GWDIS+MNLADA
Sbjct:    1 MFIESFKVESPNVKYTEGEIHSVYNYETTELVHESRNGTYQWIVKPKTVKYEFKTDTHVPKLGVMLVGWGGNNGSTLTGGVIANREGISWATKDKVQQANYFGSLTQASSIRVGSFNGEEIYAPFKSLLPMVNPDDVVFGGWDISNMNLADA 152          
BLAST of FC920482 vs. ExPASy Swiss-Prot
Match: INO2_ARATH (Inositol-3-phosphate synthase isozyme 2 OS=Arabidopsis thaliana GN=At2g22240 PE=2 SV=2)

HSP 1 Score: 289.656 bits (740), Expect = 1.103e-77
Identity = 135/152 (88.82%), Postives = 146/152 (96.05%), Query Frame = 3
Query:  270 MFIENFKVESPNVKYTDNEIHSVYDYETTELVHENRNGTYQWIVKPKTVKYEFKTDVHVPKLGVMLVGWGGNNGSTLTGGVIANREGISWATKDTVQQANYFGSLTQASAIRVGSYNGEEIYAPFKSILPMVNPDDIVLXGWDISDMNLADA 725
            MFIE+FKVESPNVKYT+NEI+SVYDYETTE+VHENRNGTYQW+VKPKTVKY+FKTD  VPKLGVMLVGWGGNNGSTLT GVIAN+EGISWATKD VQQANYFGSLTQAS+IRVGSYNGEEIYAPFKS+LPMVNP+D+V  GWDISDMNLADA
Sbjct:    1 MFIESFKVESPNVKYTENEINSVYDYETTEVVHENRNGTYQWVVKPKTVKYDFKTDTRVPKLGVMLVGWGGNNGSTLTAGVIANKEGISWATKDKVQQANYFGSLTQASSIRVGSYNGEEIYAPFKSLLPMVNPEDVVFGGWDISDMNLADA 152          
BLAST of FC920482 vs. ExPASy Swiss-Prot
Match: INO3_ARATH (Probable inositol-3-phosphate synthase isozyme 3 OS=Arabidopsis thaliana GN=At5g10170 PE=2 SV=1)

HSP 1 Score: 287.345 bits (734), Expect = 5.473e-77
Identity = 134/152 (88.16%), Postives = 145/152 (95.39%), Query Frame = 3
Query:  270 MFIENFKVESPNVKYTDNEIHSVYDYETTELVHENRNGTYQWIVKPKTVKYEFKTDVHVPKLGVMLVGWGGNNGSTLTGGVIANREGISWATKDTVQQANYFGSLTQASAIRVGSYNGEEIYAPFKSILPMVNPDDIVLXGWDISDMNLADA 725
            MFIE+FKVESPNVKYT+NEIHSVYDY+TTELVHEN+NG +QW VKPKTVKYEFKTD HVPKLGVMLVGWGGNNGSTLT GVIANREGISWATK+ VQQANYFGSLTQAS+IRVGS+NGEEIYAPFKS+LPMVNP++IV  GWDISDMNLADA
Sbjct:    1 MFIESFKVESPNVKYTENEIHSVYDYQTTELVHENKNGAFQWTVKPKTVKYEFKTDTHVPKLGVMLVGWGGNNGSTLTAGVIANREGISWATKEKVQQANYFGSLTQASSIRVGSFNGEEIYAPFKSLLPMVNPEEIVFGGWDISDMNLADA 152          
BLAST of FC920482 vs. ExPASy Swiss-Prot
Match: INO1_BRANA (Inositol-3-phosphate synthase OS=Brassica napus PE=2 SV=2)

HSP 1 Score: 283.493 bits (724), Expect = 7.903e-76
Identity = 132/152 (86.84%), Postives = 143/152 (94.08%), Query Frame = 3
Query:  270 MFIENFKVESPNVKYTDNEIHSVYDYETTELVHENRNGTYQWIVKPKTVKYEFKTDVHVPKLGVMLVGWGGNNGSTLTGGVIANREGISWATKDTVQQANYFGSLTQASAIRVGSYNGEEIYAPFKSILPMVNPDDIVLXGWDISDMNLADA 725
            MFIE+FKVESPNVKYT+NEIHSVYDYETTE+VHEN NG YQWIVKPK VKY+FKTD  VPKLGVMLVGWGGNNGSTLT GVIAN+EGISWATKD VQQANYFGSLTQAS+IRVGS+NGEE+YAPFKS++PMVNPDD+V  GWDISDMNLADA
Sbjct:    1 MFIESFKVESPNVKYTENEIHSVYDYETTEVVHENVNGAYQWIVKPKVVKYDFKTDTRVPKLGVMLVGWGGNNGSTLTAGVIANKEGISWATKDKVQQANYFGSLTQASSIRVGSFNGEEMYAPFKSLVPMVNPDDVVFGGWDISDMNLADA 152          
BLAST of FC920482 vs. ExPASy Swiss-Prot
Match: INO1_PHAVU (Inositol-3-phosphate synthase OS=Phaseolus vulgaris PE=2 SV=1)

HSP 1 Score: 279.641 bits (714), Expect = 1.141e-74
Identity = 134/153 (87.58%), Postives = 144/153 (94.12%), Query Frame = 3
Query:  270 MFIENFKVESPNVKYTDNEIHSVYDYETTELVHENR-NGTYQWIVKPKTVKYEFKTDVHVPKLGVMLVGWGGNNGSTLTGGVIANREGISWATKDTVQQANYFGSLTQASAIRVGSYNGEEIYAPFKSILPMVNPDDIVLXGWDISDMNLADA 725
            MFIE+FKVESPNVKYT+NEIHSVYDYETTE+VHE   NGTYQWIVKPKTVKY+FKTD+ VPKLGVMLVG GGNNGSTLT GVIAN+EGISWATKD VQQANYFGSLTQAS+IRVGS+NGEEIYAPFKS+LPMVNPDD+V  GWDISDMNLADA
Sbjct:    1 MFIESFKVESPNVKYTENEIHSVYDYETTEVVHEKTVNGTYQWIVKPKTVKYDFKTDIRVPKLGVMLVGLGGNNGSTLTAGVIANKEGISWATKDKVQQANYFGSLTQASSIRVGSFNGEEIYAPFKSLLPMVNPDDVVFGGWDISDMNLADA 153          
BLAST of FC920482 vs. ExPASy Swiss-Prot
Match: INO1_ARATH (Inositol-3-phosphate synthase isozyme 1 OS=Arabidopsis thaliana GN=At4g39800 PE=2 SV=3)

HSP 1 Score: 279.641 bits (714), Expect = 1.141e-74
Identity = 134/153 (87.58%), Postives = 144/153 (94.12%), Query Frame = 3
Query:  270 MFIENFKVESPNVKYTDNEIHSVYDYETTELVHENR-NGTYQWIVKPKTVKYEFKTDVHVPKLGVMLVGWGGNNGSTLTGGVIANREGISWATKDTVQQANYFGSLTQASAIRVGSYNGEEIYAPFKSILPMVNPDDIVLXGWDISDMNLADA 725
            MFIE+FKVESPNVKYT+NEIHSVYDYETTE+VHE   NGTYQWIVKPKTVKY+FKTD+ VPKLGVMLVG GGNNGSTLT GVIAN+EGISWATKD VQQANYFGSLTQAS+IRVGS+NGEEIYAPFKS+LPMVNPDD+V  GWDISDMNLADA
Sbjct:    1 MFIESFKVESPNVKYTENEIHSVYDYETTEVVHEKTVNGTYQWIVKPKTVKYDFKTDIRVPKLGVMLVGLGGNNGSTLTAGVIANKEGISWATKDKVQQANYFGSLTQASSIRVGSFNGEEIYAPFKSLLPMVNPDDVVFGGWDISDMNLADA 153          
The following BLAST results are available for this feature:
BLAST of FC920482 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 27
Match NameE-valueIdentityDescription
INO1_CITPA1.757e-8397.37Inositol-3-phosphate synthase OS=Citrus paradisi P... [more]
INO1_NICPA2.625e-7990.79Inositol-3-phosphate synthase OS=Nicotiana panicul... [more]
INO1_WHEAT5.848e-7990.13Inositol-3-phosphate synthase OS=Triticum aestivum... [more]
INO1_TOBAC7.637e-7990.79Inositol-3-phosphate synthase OS=Nicotiana tabacum... [more]
INO1_SESIN7.637e-7990.79Inositol-3-phosphate synthase OS=Sesamum indicum P... [more]
INO2_ARATH1.103e-7788.82Inositol-3-phosphate synthase isozyme 2 OS=Arabido... [more]
INO3_ARATH5.473e-7788.16Probable inositol-3-phosphate synthase isozyme 3 O... [more]
INO1_BRANA7.903e-7686.84Inositol-3-phosphate synthase OS=Brassica napus PE... [more]
INO1_PHAVU1.141e-7487.58Inositol-3-phosphate synthase OS=Phaseolus vulgari... [more]
INO1_ARATH1.141e-7487.58Inositol-3-phosphate synthase isozyme 1 OS=Arabido... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32008H12EF RVDevelop1 Citrus clementina cDNA clone C32008H12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920482 ID=FC920482|Name=FC920482|organism=Citrus clementina|type=EST|length=726bp
GATGCACAGATTACCAGGCTAGCTTCGAAAGTTAAAAGAGTGTTGAGTCG
AGTGGGAAGTGAGAATTGAGAAGGAGAGTCGAGTTCGGAGACAGCAAGAC
GAAACAGCTCTTCTTCCAATAAATCTCAAAGCATTTGTTTGGTTTTATTT
AAAGCAATTTTCTCAGCAAACTCTTCTTCTAATAAATTTTAAAGCATTTG
TTTGGTTTTTATTTAAAGCAATTTTCTCAGCGAAGTTTTCAATTTTTTCT
CTAAAATTTTCCTGGGAAAATGTTTATCGAAAATTTCAAGGTTGAGAGCC
CAAATGTGAAGTACACAGATAATGAGATTCACTCTGTGTACGATTATGAA
ACCACTGAGCTTGTTCATGAGAACAGAAATGGCACTTATCAGTGGATTGT
CAAGCCCAAAACTGTCAAATATGAGTTCAAAACCGATGTTCATGTCCCTA
AACTTGGGGTTATGCTTGTGGGTTGGGGTGGAAACAACGGCTCAACTCTC
ACGGGTGGTGTTATCGCGAATCGAGAGGGAATCTCCTGGGCCACAAAGGA
CACAGTGCAACAAGCCAATTATTTTGGTTCACTTACCCAAGCATCAGCAA
TTAGAGTTGGGTCTTACAATGGAGAGGAGATTTATGCTCCATTCAAGAGC
ATTCTCCCTATGGTGAACCCAGATGACATTGTGTTGGNAGGATGGGACAT
TAGTGACATGAACTTGGCTGATGCCA
back to top