FC920485

Overview
NameFC920485
Unique NameFC920485
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length705
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9492 contig Ccv1_Contig9492:17..721. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920485 vs. ExPASy Swiss-Prot
Match: PER42_ARATH (Peroxidase 42 OS=Arabidopsis thaliana GN=PER42 PE=1 SV=2)

HSP 1 Score: 347.821 bits (891), Expect = 3.265e-95
Identity = 163/194 (84.02%), Postives = 182/194 (93.81%), Query Frame = 3
Query:  123 EEDPGLVMNFYKDTCPQAEDIIKEQVKLLYKRHKNTAFSWLRNIFHDCAVQSCDASLLLDSTRKTLSEKEMDRSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLYPEVDPAL 704
            E +PGL+MNFYKDTCPQAEDI++EQVKLLYKRHKNTAFSWLRNIFHDCAV+SCDASLLLDSTR+ L EKE DRSFG+RNFRYIE IKEA+ERECPGVVSC+DILVLS R+G+ A+GGPYIPLKTGRRDG KSR ++LE YLPDHN+S+SVVLE+F +IGID PGLVALLGSHSVGRTHCVKLVHRLYPEVDP+L
Sbjct:   26 EAEPGLMMNFYKDTCPQAEDIVREQVKLLYKRHKNTAFSWLRNIFHDCAVESCDASLLLDSTRRELGEKEHDRSFGLRNFRYIEEIKEALERECPGVVSCSDILVLSAREGIEAVGGPYIPLKTGRRDGLKSRTDMLESYLPDHNESISVVLEKFKSIGIDTPGLVALLGSHSVGRTHCVKLVHRLYPEVDPSL 219          
BLAST of FC920485 vs. ExPASy Swiss-Prot
Match: PER21_ARATH (Peroxidase 21 OS=Arabidopsis thaliana GN=PER21 PE=1 SV=1)

HSP 1 Score: 244.973 bits (624), Expect = 2.980e-64
Identity = 116/190 (61.05%), Postives = 148/190 (77.89%), Query Frame = 3
Query:  138 LVMNFYKDTCPQAEDIIKEQVKLLYKRHKNTAFSWLRNIFHDCAVQSCDASLLLDSTRKTLSEKEMDRSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIP-LKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLYPEVDPAL 704
            L MN+YK++CP+AE+II++QV+ LY +H NTA SWLRN+FHDC V+SCDASLLL++ R   SE++  RSFGMRNF+Y++ IK+A+E+ECP  VSCADI+ LS RDG+V L GP I  +KTGRRD R S    +E  +P+HNDS+S V+  F +IGID    VALLG+HSVGR HCV LVHRLYP +DP L
Sbjct:   30 LEMNYYKESCPKAEEIIRQQVETLYYKHGNTAVSWLRNLFHDCVVKSCDASLLLETARGVESEQKSKRSFGMRNFKYVKIIKDALEKECPSTVSCADIVALSARDGIVMLKGPKIEMIKTGRRDSRGSYLGDVETLIPNHNDSLSSVISTFNSIGIDVEATVALLGAHSVGRVHCVNLVHRLYPTIDPTL 219          
BLAST of FC920485 vs. ExPASy Swiss-Prot
Match: PER48_ARATH (Putative Peroxidase 48 OS=Arabidopsis thaliana GN=PER48 PE=2 SV=3)

HSP 1 Score: 156.377 bits (394), Expect = 1.394e-37
Identity = 75/193 (38.86%), Postives = 120/193 (62.18%), Query Frame = 3
Query:  147 NFYKDTCPQAEDIIKEQVKLLYKRHKNTAFSWLRNIFHDCAVQSCDASLLLDSTRKTLSEKEMDRSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLY---------PEVDP 698
            ++Y+++CP AE II + ++ +Y    + A   +R +FHDC ++ CDAS+LLD+     SEK+   +  ++ F  I+ +K  +E  CPGVVSCAD+LVL+ R+ V+  GGP+ PL+TGR+D   +  +  E  LP  + ++SV+L+RF+  G +    V+L G+HS+G THC    +RLY         PE++P
Sbjct:   71 DYYRESCPTAEKIIAKAIRDIYNVTPSVAPPIIRLLFHDCFIEGCDASVLLDADEAHTSEKDASPNLSLKGFDVIDAVKSELENVCPGVVSCADLLVLAAREAVLVAGGPFYPLETGRKDSAAAYRDFAEHELPAPDATLSVILQRFSFRGFNERETVSLFGAHSIGITHCTFFKNRLYNFSATGKPDPELNP 263          
BLAST of FC920485 vs. ExPASy Swiss-Prot
Match: PER52_ARATH (Peroxidase 52 OS=Arabidopsis thaliana GN=PER52 PE=2 SV=1)

HSP 1 Score: 145.206 bits (365), Expect = 3.214e-34
Identity = 75/187 (40.11%), Postives = 101/187 (54.01%), Query Frame = 3
Query:  138 LVMNFYKDTCPQAEDIIKEQVKLLYKRHKNTAFSWLRNIFHDCAVQSCDASLLLDSTRKTLSEKEM-DRSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLYPEVD 695
            L  NFY  +CP     ++  VK           S LR  FHDC V  CD S+LLD T     E+         R F  I+NIK AVE+ CPGVVSCADIL ++ RD VVALGGP   +K GRRD R +        +P    S+S ++  F+A+G+    +VAL G+H++G++ C     R+Y E +
Sbjct:   30 LTTNFYSTSCPNLLSTVQTAVKSAVNSEARMGASILRLFFHDCFVNGCDGSILLDDTSSFTGEQNAAPNRNSARGFNVIDNIKSAVEKACPGVVSCADILAIAARDSVVALGGPNWNVKVGRRDARTASQAAANSNIPAPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCTNFRARIYNETN 216          
BLAST of FC920485 vs. ExPASy Swiss-Prot
Match: PER11_ARATH (Peroxidase 11 OS=Arabidopsis thaliana GN=PER11 PE=1 SV=1)

HSP 1 Score: 144.821 bits (364), Expect = 4.198e-34
Identity = 65/187 (34.76%), Postives = 109/187 (58.29%), Query Frame = 3
Query:  126 EDPGLVMNFYKDTCPQAEDIIKEQVKLLYKRHKNTAFSWLRNIFHDCAVQSCDASLLLDSTRKTLSEKEMDRSFG-MRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLY 683
            +D  L +++YK TCP   D+IK++++ + K     A   +R  FHDC VQ CD S+LLD T     EK+   +   ++ ++ ++ IK  +E ECPGVVSCAD+L +  RD  + +GGPY  +  GR+D + +  E+    LP   + +  ++ +F + G+    +VAL+G+H++G+  C     R+Y
Sbjct:   26 KDLPLTLDYYKSTCPTVFDVIKKEMECIVKEDPRNAAIIIRLHFHDCFVQGCDGSVLLDETETLQGEKKASPNINSLKGYKIVDRIKNIIESECPGVVSCADLLTIGARDATILVGGPYWDVPVGRKDSKTASYELATTNLPTPEEGLISIIAKFYSQGLSVEDMVALIGAHTIGKAQCRNFRSRIY 212          
BLAST of FC920485 vs. ExPASy Swiss-Prot
Match: PER56_ARATH (Peroxidase 56 OS=Arabidopsis thaliana GN=PER56 PE=2 SV=1)

HSP 1 Score: 144.436 bits (363), Expect = 5.482e-34
Identity = 74/183 (40.44%), Postives = 109/183 (59.56%), Query Frame = 3
Query:  135 GLVMNFYKDTCPQAEDIIKEQVKLLYKRHKNTAFSWLRNIFHDCAVQSCDASLLLDSTRKTLSEKEMDRSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLY 683
            GL + FY   CP+AE I+K+ V    K  +  A   LR  FHDC V+ C+ S+LL+   K   EK    +  +R F  I+N+K A+E+ECPG+VSC+D+L L  RD +VAL GP   ++TGRRDG  +        LP   +++S ++ +F + G+D   LV L G H++G  HC ++ +RLY
Sbjct:   31 GLKVGFYDKACPKAELIVKKSVFEAVKNDRTIAAPLLRMFFHDCFVRGCEGSVLLELKNKK-DEKNSIPNLTLRGFEIIDNVKAALEKECPGIVSCSDVLALVARDAMVALNGPSWEVETGRRDGLVTNITEALLNLPSPFNNISSLITQFQSKGLDKKDLVVLSGGHTIGNGHCPQITNRLY 212          
BLAST of FC920485 vs. ExPASy Swiss-Prot
Match: PER41_ARATH (Peroxidase 41 OS=Arabidopsis thaliana GN=PER41 PE=2 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 2.083e-33
Identity = 76/193 (39.38%), Postives = 112/193 (58.03%), Query Frame = 3
Query:  132 PGLVMNFYKDTCPQAEDIIKEQVKLLYKRHKNTAFSWLRNIFHDCAVQSCDASLLL--DSTRKTLSEKEMDRSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLYPEVDPAL 704
            P L  ++Y+ TCP    I++E V     +   TA   LR  FHDC ++ CDAS+L+  +S  K   + +++ S     F  +  IK A+E  CPGVVSCADIL  + RD V  +GGP+  +K GR+DG +S+A  ++  LP  N S+  +L  F   G     LVAL G H++G +HC +  +R++P+VDP L
Sbjct:   24 PNLTKDYYQKTCPDFNKIVRETVTPKQGQQPTTAAGTLRLFFHDCFMEGCDASVLIATNSFNKAERDDDLNESLPGDAFDIVTRIKTALELSCPGVVSCADILAQATRDLVTMVGGPFYEVKLGRKDGFESKAHKVKGNLPLANQSVPDMLSIFKKNGFTLKELVALSGGHTIGFSHCKEFSNRIFPKVDPEL 216          
BLAST of FC920485 vs. ExPASy Swiss-Prot
Match: PER17_ARATH (Peroxidase 17 OS=Arabidopsis thaliana GN=PER17 PE=2 SV=1)

HSP 1 Score: 141.739 bits (356), Expect = 3.553e-33
Identity = 71/191 (37.17%), Postives = 110/191 (57.59%), Query Frame = 3
Query:  150 FYKDTCPQAEDIIKEQVKLLYKRHKNTAFSWLRNIFHDCAVQSCDASLLLDSTRKTLSEK-EMDRSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLYPE-----VDPAL 704
            FY +TCP+AE I++ ++K    +   +  S +R  FHDC V  CDASLLLD T   L EK  +     +R+F  +++IKEA+E+ CP  VSCADI++++ RD V   GGP   +K GR+D   +  +  +  +P    + + +++ F    +    +VAL GSHS+G+  C  ++ RLY +      DPAL
Sbjct:   27 FYSETCPEAESIVRREMKKAMIKEARSVASVMRFQFHDCFVNGCDASLLLDDTPNMLGEKLSLSNIDSLRSFEVVDDIKEALEKACPATVSCADIVIMAARDAVALTGGPDWEVKLGRKDSLTASQQDSDDIMPSPRANATFLIDLFERFNLSVKDMVALSGSHSIGQGRCFSIMFRLYNQSGSGKPDPAL 217          
BLAST of FC920485 vs. ExPASy Swiss-Prot
Match: PER4_VITVI (Peroxidase 4 OS=Vitis vinifera GN=GSVIVT00023967001 PE=1 SV=1)

HSP 1 Score: 141.354 bits (355), Expect = 4.641e-33
Identity = 73/187 (39.04%), Postives = 102/187 (54.55%), Query Frame = 3
Query:  138 LVMNFYKDTCPQAEDIIKEQVKLLYKRHKNTAFSWLRNIFHDCAVQSCDASLLLDSTRKTLSEKE-MDRSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLYPEVD 695
            L  NFY  TCP+  D +K  V+    + +    S LR  FHDC V  CDAS+LLD T     E+  +     +R    I+NIK  VE  CPGVVSCADI+ ++ RD VV LGGP   +K GRRD + +        +P    S+S ++ +F A G+    +VAL G+H++G+  C     R+Y E +
Sbjct:   27 LSTNFYSKTCPKVFDTVKSGVQSAVSKERRMGASLLRLFFHDCFVNGCDASVLLDDTSSFTGEQTAVPNKNSIRGLNVIDNIKSQVESVCPGVVSCADIIAIAARDSVVILGGPDWDVKLGRRDSKTASLSGANNNIPPPTSSLSNLISKFQAQGLSTRDMVALSGAHTIGQARCTSFRARIYNETN 213          
BLAST of FC920485 vs. ExPASy Swiss-Prot
Match: PERP7_BRARA (Peroxidase P7 OS=Brassica rapa PE=1 SV=3)

HSP 1 Score: 140.969 bits (354), Expect = 6.061e-33
Identity = 74/187 (39.57%), Postives = 102/187 (54.55%), Query Frame = 3
Query:  138 LVMNFYKDTCPQAEDIIKEQVKLLYKRHKNTAFSWLRNIFHDCAVQSCDASLLLDSTRKTLSEKEMDRSFGM-RNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLYPEVD 695
            L  NFY  +CP     +K  VK           S LR  FHDC V  CD S+LLD T     E+    +    R F  I +IK AVE+ CPGVVSCADIL ++ RD VV LGGP   +K GRRD + +        +P  + S+S ++  F+A+G+    +VAL G+H++G++ CV    R+Y E +
Sbjct:    2 LTTNFYSTSCPNLLSTVKSGVKSAVSSQPRMGASILRLFFHDCFVNGCDGSILLDDTSSFTGEQNAGPNRNSARGFTVINDIKSAVEKACPGVVSCADILAIAARDSVVQLGGPNWNVKVGRRDAKTASQAAANSNIPAPSMSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCVNFRARVYNETN 188          
The following BLAST results are available for this feature:
BLAST of FC920485 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 108
Match NameE-valueIdentityDescription
PER42_ARATH3.265e-9584.02Peroxidase 42 OS=Arabidopsis thaliana GN=PER42 PE=... [more]
PER21_ARATH2.980e-6461.05Peroxidase 21 OS=Arabidopsis thaliana GN=PER21 PE=... [more]
PER48_ARATH1.394e-3738.86Putative Peroxidase 48 OS=Arabidopsis thaliana GN=... [more]
PER52_ARATH3.214e-3440.11Peroxidase 52 OS=Arabidopsis thaliana GN=PER52 PE=... [more]
PER11_ARATH4.198e-3434.76Peroxidase 11 OS=Arabidopsis thaliana GN=PER11 PE=... [more]
PER56_ARATH5.482e-3440.44Peroxidase 56 OS=Arabidopsis thaliana GN=PER56 PE=... [more]
PER41_ARATH2.083e-3339.38Peroxidase 41 OS=Arabidopsis thaliana GN=PER41 PE=... [more]
PER17_ARATH3.553e-3337.17Peroxidase 17 OS=Arabidopsis thaliana GN=PER17 PE=... [more]
PER4_VITVI4.641e-3339.04Peroxidase 4 OS=Vitis vinifera GN=GSVIVT0002396700... [more]
PERP7_BRARA6.061e-3339.57Peroxidase P7 OS=Brassica rapa PE=1 SV=3[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32009A06EF RVDevelop1 Citrus clementina cDNA clone C32009A06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920485 ID=FC920485|Name=FC920485|organism=Citrus clementina|type=EST|length=705bp
GAAGGTTGGTCACCTTTAGTGAGTGAAGAGTAGAAGAGACAATGGGTACG
AAAGCTGTCTTCTTGCTTTTAGCTTTGCTTTCCTTCTCAGCTGTGTCTCT
GAGGTCTGCTTTGGCAGAAAATGAAGAGGACCCAGGTCTTGTTATGAATT
TTTACAAGGATACATGCCCTCAGGCCGAGGACATTATCAAGGAACAAGTT
AAGCTTCTGTACAAGCGCCACAAGAACACTGCATTTTCTTGGCTTAGAAA
CATTTTCCATGACTGTGCTGTCCAGTCTTGTGATGCTTCACTGCTTCTGG
ACTCGACAAGAAAGACCTTGTCTGAGAAGGAAATGGACAGGAGCTTTGGT
ATGAGGAACTTCAGGTACATTGAGAACATCAAAGAAGCTGTTGAAAGAGA
GTGCCCTGGTGTTGTTTCCTGTGCTGATATTCTTGTCCTGTCCGGTAGAG
ATGGCGTTGTTGCGCTTGGAGGCCCTTACATTCCTCTCAAGACAGGAAGA
AGAGATGGTAGAAAAAGCAGAGCAGAGATACTTGAGCAGTATCTCCCAGA
TCACAATGACAGCATGTCTGTTGTTCTTGAGAGGTTTGCAGCCATTGGCA
TTGACGCCCCTGGACTTGTTGCACTGCTAGGATCTCACAGTGTTGGCAGA
ACTCATTGTGTGAAGCTGGTGCACCGTCTGTACCCAGAAGTTGACCCTGC
ACTGA
back to top