FC920486

Overview
NameFC920486
Unique NameFC920486
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length567
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10346 contig Ccv1_Contig10346:10..576. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920486 vs. ExPASy Swiss-Prot
Match: DR100_ARATH (DNA-damage-repair/toleration protein DRT100 OS=Arabidopsis thaliana GN=DRT100 PE=2 SV=2)

HSP 1 Score: 193.741 bits (491), Expect = 5.209e-49
Identity = 92/156 (58.97%), Postives = 116/156 (74.36%), Query Frame = 1
Query:  103 AQLLLIFLAXXXXXXNCCPPSERAALLAFKAALHEPYLGIFNSWTGN-DCCHNWYGVSCDQETHRVADINLRGESEDPIFQRAHRTGYMTGYISPAVCKLTRLSSFTLADWKGITGEIPRCISSIPFLRILDLIGNKLSGDIPPDIGRPHRLAVLN 567
            + LL +          CC P ++ AL AFK++L EP LGIFN+W+ N DCC  WYG+SCD ++ RV DI+LRGESED IFQ+A R+GYM+G I PAVC LT L+S  LADWKGITGEIP CI+S+  LRILDL GNK++G+IP +IG+  +LAVLN
Sbjct:   10 SSLLAVVFISVISVVRCCSPKDQTALNAFKSSLSEPNLGIFNTWSENTDCCKEWYGISCDPDSGRVTDISLRGESEDAIFQKAGRSGYMSGSIDPAVCDLTALTSLVLADWKGITGEIPPCITSLASLRILDLAGNKITGEIPAEIGKLSKLAVLN 165          
BLAST of FC920486 vs. ExPASy Swiss-Prot
Match: PGIP_VITVI (Polygalacturonase inhibitor OS=Vitis vinifera GN=pgip PE=1 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 3.190e-14
Identity = 56/170 (32.94%), Postives = 75/170 (44.12%), Query Frame = 1
Query:  100 TAQLLLIFLAXXXXXX--NCCPPSERAALLAFKAALHEPYLGIFNSWTGNDCCHNWYGVSCDQETHRVADIN-----LRGESEDPIFQRA-------HRTGYMTGYISPAVCKLTRLSSFTLADWKGITGEIPRCISSIPFLRILDLIGNKLSGDIP------PDIGRPH 549
            ++ LLL+ LA          C P ++  LL  K AL  PY  I  SW  N  C  WY V CD  THR+  +      L G+  D +            +   +TG I PA+ KL  L    L+ W  ++G +P   S +  L  LDL  N LSG IP      P++G  H
Sbjct:   10 SSSLLLVLLATRPCPSLSERCNPKDKKVLLQIKKALDNPY--ILASWNPNTDCCGWYCVECDLTTHRINSLTIFSGQLSGQIPDAVGDLPFLETLIFRKLSNLTGQIPPAIAKLKHLKMVRLS-WTNLSGPVPAFFSELKNLTYLDLSFNNLSGPIPGSLSLLPNLGALH 176          
BLAST of FC920486 vs. ExPASy Swiss-Prot
Match: PGIP1_ORYSJ (Polygalacturonase inhibitor 1 OS=Oryza sativa subsp. japonica GN=FOR1 PE=2 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 4.311e-11
Identity = 49/156 (31.41%), Postives = 72/156 (46.15%), Query Frame = 1
Query:   76 MGGCVSFYTAQLLLIFLAXXXXXXNCCPPSERAALLAFKAALHEPYLGIFNSWTGNDCCHNWYGVSCDQETHRVADINLRGESEDPIFQRAHRTGYMTGYISPAVCKLTRLSSFTLADWKGITGEIPRCISSIPFLRILDLIGNKLSGDIPPDIGR 543
            M    SF  A LL + +A        CPPS++ AL+  K +L  P      S    DCC  W  V CD E  RV ++ + G ++            + G I  AV  LT L S +L    G++G IP C++++  L+ L +    +SG IP  + R
Sbjct:    1 MASTASFMLAVLLAVAVAAAPARAVRCPPSDKQALMRVKQSLGNPATLSTWSLASADCC-EWDHVRCD-EAGRVNNVFIDGAND------------VRGQIPSAVAGLTALMSLSLFRLPGLSGPIPACLTALSNLQFLTISHTNVSGVIPDSLAR 142          
The following BLAST results are available for this feature:
BLAST of FC920486 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
DR100_ARATH5.209e-4958.97DNA-damage-repair/toleration protein DRT100 OS=Ara... [more]
PGIP_VITVI3.190e-1432.94Polygalacturonase inhibitor OS=Vitis vinifera GN=p... [more]
PGIP1_ORYSJ4.311e-1131.41Polygalacturonase inhibitor 1 OS=Oryza sativa subs... [more]
back to top
Properties
Property NameValue
Genbank descriptionC32009A07EF RVDevelop1 Citrus clementina cDNA clone C32009A07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920486 ID=FC920486|Name=FC920486|organism=Citrus clementina|type=EST|length=567bp
GATGCTCAAACTCAATCCACTTCACTTCCCAACGTAAACCCAAAACTCAT
CGTTTCGGATCAAGCAAAAACCAACATGGGTGGCTGTGTCTCGTTTTACA
CTGCGCAGCTTCTTCTAATCTTCCTCGCCGTTAGTTCTTCCGTCGTTAAT
TGCTGCCCGCCGTCAGAGCGGGCAGCACTCTTAGCCTTCAAAGCTGCCCT
CCACGAGCCTTACTTGGGCATCTTCAACTCCTGGACGGGCAACGACTGTT
GCCACAACTGGTACGGTGTTAGCTGTGACCAGGAAACTCACCGGGTCGCT
GACATTAACCTACGTGGCGAGTCTGAGGATCCGATATTCCAGCGGGCCCA
CCGAACCGGGTACATGACCGGGTATATCTCACCCGCTGTGTGTAAACTCA
CGCGTCTCTCCAGTTTCACGCTCGCCGACTGGAAAGGCATCACCGGGGAA
ATCCCACGTTGCATTTCTTCAATTCCTTTTCTCCGCATTCTTGATTTAAT
CGGAAATAAGTTATCGGGCGACATTCCCCCAGATATCGGCCGGCCTCACA
GACTCGCTGTCTTAAAT
back to top