FC920488

Overview
NameFC920488
Unique NameFC920488
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length695
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
FC920488_ssr21 microsatellite FC920488_ssr21:21..40. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig14141 contig Ccv1_Contig14141:1..695. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920488 vs. ExPASy Swiss-Prot
Match: EXPA4_ARATH (Expansin-A4 OS=Arabidopsis thaliana GN=EXPA4 PE=1 SV=1)

HSP 1 Score: 365.925 bits (938), Expect = 1.130e-100
Identity = 164/193 (84.97%), Postives = 181/193 (93.78%), Query Frame = 3
Query:  117 LFATANAKIPGVFAGGPWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSCGACFELKCGGDPQWCNPGNPAILITATNFCPPNFAQPSDNGGWCNPPRPHFDLAMPMFLKLAQYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLVTNVAGAGDIVRVSVKGANTQWLSMSRN 695
            LF+ A+A+IPG+++GG WQ+AHATFYGGSDASGTMGGACGYGNLYSQGYG NTAALSTALFNNG+SCGACFELKC  DPQWC+ G+P+ILITATNFCPPN AQPSDNGGWCNPPR HFDLAMP+FLK+AQYRAGIVPVSYRRVPCRKRGGIRFTING RYFNLVL+TNVAGAGDIVR SVKG+ T W+S+SRN
Sbjct:   14 LFSLADARIPGIYSGGAWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGMSCGACFELKCANDPQWCHSGSPSILITATNFCPPNLAQPSDNGGWCNPPREHFDLAMPVFLKIAQYRAGIVPVSYRRVPCRKRGGIRFTINGHRYFNLVLITNVAGAGDIVRASVKGSRTGWMSLSRN 206          
BLAST of FC920488 vs. ExPASy Swiss-Prot
Match: EXPA6_ARATH (Expansin-A6 OS=Arabidopsis thaliana GN=EXPA6 PE=2 SV=2)

HSP 1 Score: 365.54 bits (937), Expect = 1.476e-100
Identity = 164/198 (82.83%), Postives = 183/198 (92.42%), Query Frame = 3
Query:  102 SVALSLFATANAKIPGVFAGGPWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSCGACFELKCGGDPQWCNPGNPAILITATNFCPPNFAQPSDNGGWCNPPRPHFDLAMPMFLKLAQYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLVTNVAGAGDIVRVSVKGANTQWLSMSRN 695
            SV  ++ A + A+IPGV+ GG W++AHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNG SCGACFELKC  DP+WC+ G+P+I ITATNFCPPNFAQPSDNGGWCNPPRPHFDLAMPMFLK+A+YRAGIVPVS+RRVPCRKRGGIRFTINGFRYFNLVLVTNVAGAG+IVR+ VKG +T W++MSRN
Sbjct:    9 SVLTTILALSEARIPGVYNGGGWETAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGFSCGACFELKCASDPKWCHSGSPSIFITATNFCPPNFAQPSDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRKRGGIRFTINGFRYFNLVLVTNVAGAGNIVRLGVKGTHTSWMTMSRN 206          
BLAST of FC920488 vs. ExPASy Swiss-Prot
Match: EXPA3_ARATH (Expansin-A3 OS=Arabidopsis thaliana GN=EXPA3 PE=2 SV=1)

HSP 1 Score: 365.155 bits (936), Expect = 1.927e-100
Identity = 169/206 (82.04%), Postives = 184/206 (89.32%), Query Frame = 3
Query:   81 FRMLCFFSVALSLFATA-NAKIPGVFAGGPWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSCGACFELKCGGDPQWCNPGNPAILITATNFCPPNFAQPSDNGGWCNPPRPHFDLAMPMFLKLAQYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLVTNVAGAGDIVRVSVKGANTQWLSMSRN 695
            FR+  + +V  S   TA NAKIPGV++GGPWQ+AHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNG SCGACFE+KC  DP+WC PGNP+IL+TATNFCPPNFAQPSD+GGWCNPPR HFDLAMPMFLK+  YRAGIVPVSYRRVPCRK GGIRFT+NGFRYFNLVLVTNVAGAGDI  VSVKG+ T W+ MSRN
Sbjct:    6 FRVGLWLAVTASFLLTATNAKIPGVYSGGPWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGFSCGACFEIKCTDDPRWCVPGNPSILVTATNFCPPNFAQPSDDGGWCNPPREHFDLAMPMFLKIGLYRAGIVPVSYRRVPCRKIGGIRFTVNGFRYFNLVLVTNVAGAGDINGVSVKGSKTDWVRMSRN 211          
BLAST of FC920488 vs. ExPASy Swiss-Prot
Match: EXPA9_ARATH (Expansin-A9 OS=Arabidopsis thaliana GN=EXPA9 PE=2 SV=1)

HSP 1 Score: 364.385 bits (934), Expect = 3.287e-100
Identity = 164/204 (80.39%), Postives = 185/204 (90.69%), Query Frame = 3
Query:   84 RMLCFFSVALSLFATANAKIPGVFAGGPWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSCGACFELKCGGDPQWCNPGNPAILITATNFCPPNFAQPSDNGGWCNPPRPHFDLAMPMFLKLAQYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLVTNVAGAGDIVRVSVKGANTQWLSMSRN 695
            +++ F +V +    TANAKIPGV+ GGPW +AHATFYG +DASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSCG+CFELKC  DP WC PGNP+ILITATNFCPPNF Q SDNGGWCNPPR HFDLAMPMFL +A+Y+AGIVPVSYRR+PCRK+GGIRFTINGF+YFNLVLVTNVAGAGD+++VSVKG+NTQWL +SRN
Sbjct:    4 KVITFMAVMVVTAFTANAKIPGVYTGGPWINAHATFYGEADASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSCGSCFELKCINDPGWCLPGNPSILITATNFCPPNFNQASDNGGWCNPPREHFDLAMPMFLSIAKYKAGIVPVSYRRIPCRKKGGIRFTINGFKYFNLVLVTNVAGAGDVIKVSVKGSNTQWLDLSRN 207          
BLAST of FC920488 vs. ExPASy Swiss-Prot
Match: EXPA7_ORYSJ (Expansin-A7 OS=Oryza sativa subsp. japonica GN=EXPA7 PE=2 SV=1)

HSP 1 Score: 348.206 bits (892), Expect = 2.438e-95
Identity = 160/199 (80.40%), Postives = 178/199 (89.45%), Query Frame = 3
Query:  105 VALSLFATANAKIPGVFAGGPWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSCGACFELKCGGDP--QWCNPGNPAILITATNFCPPNFAQPSDNGGWCNPPRPHFDLAMPMFLKLAQYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLVTNVAGAGDIVRVSVKGANTQWLSMSRN 695
            VAL + + A  +IPG + GG WQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVN AALSTALFN+G SCGACFE+KC   P  +WC+PG+P+ILITATNFCPPN+A PSDNGGWCNPPRPHFDLAMPMFL +A+YRAGIVPVSYRRVPCRK+GG+RFTINGFRYFNLVL+TNVAGAGDIVR SVKG +T W+ MSRN
Sbjct:   16 VALQV-SPAAGRIPGAYGGGEWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNNAALSTALFNSGQSCGACFEIKCVNQPGWEWCHPGSPSILITATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMFLHIAEYRAGIVPVSYRRVPCRKKGGVRFTINGFRYFNLVLITNVAGAGDIVRASVKGTSTGWMPMSRN 213          
BLAST of FC920488 vs. ExPASy Swiss-Prot
Match: EXP16_ARATH (Expansin-A16 OS=Arabidopsis thaliana GN=EXPA16 PE=2 SV=1)

HSP 1 Score: 342.813 bits (878), Expect = 1.024e-93
Identity = 155/203 (76.35%), Postives = 178/203 (87.68%), Query Frame = 3
Query:   87 MLCFFSVALSLFATANAKIPGVFAGGPWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSCGACFELKCGGDPQWCNPGNPAILITATNFCPPNFAQPSDNGGWCNPPRPHFDLAMPMFLKLAQYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLVTNVAGAGDIVRVSVKGANTQWLSMSRN 695
            +L  F + L L  T +A IP VF+GG WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYG NTAALST+LFN+G SCGACFE+KC  DP+WC+PGNP++ +TATNFCPPN AQPSDNGGWCNPPR HFDLAMP+FLK+A+YRAGIVP+SYRRV CRK GGIRFTING RYFNLVL+TNVAGAGDI R SVKG+ T W+S++RN
Sbjct:    8 LLTIFPLFLLLSFT-DAGIPRVFSGGSWQTAHATFYGGNDASGTMGGACGYGNLYSQGYGTNTAALSTSLFNSGQSCGACFEIKCVNDPKWCHPGNPSVFVTATNFCPPNLAQPSDNGGWCNPPRSHFDLAMPVFLKIAEYRAGIVPISYRRVACRKSGGIRFTINGHRYFNLVLITNVAGAGDIARTSVKGSKTGWMSLTRN 209          
BLAST of FC920488 vs. ExPASy Swiss-Prot
Match: EXP15_ARATH (Expansin-A15 OS=Arabidopsis thaliana GN=EXPA15 PE=2 SV=2)

HSP 1 Score: 300.056 bits (767), Expect = 7.613e-81
Identity = 141/197 (71.57%), Postives = 160/197 (81.22%), Query Frame = 3
Query:  105 VALSLFATANAKIPGVFAGGPWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSCGACFELKCGGDPQWCNPGNPAILITATNFCPPNFAQPSDNGGWCNPPRPHFDLAMPMFLKLAQYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLVTNVAGAGDIVRVSVKGANTQWLSMSRN 695
            +AL  FA     + G  AG  W +AHATFYGGSDASGTMGGACGYGNLYSQGYG NTAALSTALFNNGLSCGACFE+KC  D  WC PG  AI++TATNFCPPN A P++ GGWCNPP  HFDL+ P+F ++AQY+AG+VPVSYRRVPC +RGGIRFTING  YFNLVLVTNV GAGD+  V+VKG+ T+W  MSRN
Sbjct:   11 IALFCFAAMVCSVHGYDAG--WVNAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGACFEIKCQSDGAWCLPG--AIIVTATNFCPPNNALPNNAGGWCNPPLHHFDLSQPVFQRIAQYKAGVVPVSYRRVPCMRRGGIRFTINGHSYFNLVLVTNVGGAGDVHSVAVKGSRTRWQQMSRN 203          
BLAST of FC920488 vs. ExPASy Swiss-Prot
Match: EXPA1_ARATH (Expansin-A1 OS=Arabidopsis thaliana GN=EXPA1 PE=2 SV=1)

HSP 1 Score: 295.434 bits (755), Expect = 1.875e-79
Identity = 133/181 (73.48%), Postives = 154/181 (85.08%), Query Frame = 3
Query:  153 FAGGPWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSCGACFELKCGGDPQWCNPGNPAILITATNFCPPNFAQPSDNGGWCNPPRPHFDLAMPMFLKLAQYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLVTNVAGAGDIVRVSVKGANTQWLSMSRN 695
            +AGG W +AHATFYGG DASGTMGGACGYGNLYSQGYG NTAALSTALFNNGLSCGACFE++C  D +WC PG+  I++TATNFCPPN A P++ GGWCNPP+ HFDL+ P+F ++AQYRAGIVPV+YRRVPC +RGGIRFTING  YFNLVL+TNV GAGD+    VKG+ T W +MSRN
Sbjct:   22 YAGGGWVNAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGACFEIRCQNDGKWCLPGS--IVVTATNFCPPNNALPNNAGGWCNPPQQHFDLSQPVFQRIAQYRAGIVPVAYRRVPCVRRGGIRFTINGHSYFNLVLITNVGGAGDVHSAMVKGSRTGWQAMSRN 200          
BLAST of FC920488 vs. ExPASy Swiss-Prot
Match: EXP10_ARATH (Expansin-A10 OS=Arabidopsis thaliana GN=EXPA10 PE=2 SV=1)

HSP 1 Score: 293.893 bits (751), Expect = 5.456e-79
Identity = 132/179 (73.74%), Postives = 153/179 (85.47%), Query Frame = 3
Query:  159 GGPWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSCGACFELKCGGDPQWCNPGNPAILITATNFCPPNFAQPSDNGGWCNPPRPHFDLAMPMFLKLAQYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLVTNVAGAGDIVRVSVKGANTQWLSMSRN 695
            GG W +AHATFYGG DASGTMGGACGYGNLYSQGYG +TAALSTALFNNGLSCG+CFE++C  D +WC PG+  I++TATNFCPPN A  ++NGGWCNPP  HFDLA P+F ++AQYRAGIVPVSYRRVPCR+RGGIRFTING  YFNLVL+TNV GAGD+   ++KG+ T W +MSRN
Sbjct:   23 GGGWINAHATFYGGGDASGTMGGACGYGNLYSQGYGTSTAALSTALFNNGLSCGSCFEIRCENDGKWCLPGS--IVVTATNFCPPNNALANNNGGWCNPPLEHFDLAQPVFQRIAQYRAGIVPVSYRRVPCRRRGGIRFTINGHSYFNLVLITNVGGAGDVHSAAIKGSRTVWQAMSRN 199          
BLAST of FC920488 vs. ExPASy Swiss-Prot
Match: EXPA2_ORYSJ (Expansin-A2 OS=Oryza sativa subsp. japonica GN=EXPA2 PE=2 SV=2)

HSP 1 Score: 293.508 bits (750), Expect = 7.126e-79
Identity = 131/178 (73.60%), Postives = 150/178 (84.27%), Query Frame = 3
Query:  162 GPWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSCGACFELKCGGDPQWCNPGNPAILITATNFCPPNFAQPSDNGGWCNPPRPHFDLAMPMFLKLAQYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLVTNVAGAGDIVRVSVKGANTQWLSMSRN 695
            G WQSAHATFYGG DASGTMGGACGYGNLYS GYG NTAALST LFN+G +CG+C+EL+C  D QWC PG+  + +TATN CPPN+A P+D+GGWCNPPRPHFD+A P FL++  YRAGIVPVSYRRVPC K+GGIRFTING  YFNLVLVTNVAG GD+  VS+KG++T W  MSRN
Sbjct:   27 GSWQSAHATFYGGGDASGTMGGACGYGNLYSTGYGTNTAALSTVLFNDGAACGSCYELRCDNDGQWCLPGS--VTVTATNLCPPNYALPNDDGGWCNPPRPHFDMAEPAFLQIGVYRAGIVPVSYRRVPCVKKGGIRFTINGHSYFNLVLVTNVAGPGDVQSVSIKGSSTGWQPMSRN 202          
The following BLAST results are available for this feature:
BLAST of FC920488 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 91
Match NameE-valueIdentityDescription
EXPA4_ARATH1.130e-10084.97Expansin-A4 OS=Arabidopsis thaliana GN=EXPA4 PE=1 ... [more]
EXPA6_ARATH1.476e-10082.83Expansin-A6 OS=Arabidopsis thaliana GN=EXPA6 PE=2 ... [more]
EXPA3_ARATH1.927e-10082.04Expansin-A3 OS=Arabidopsis thaliana GN=EXPA3 PE=2 ... [more]
EXPA9_ARATH3.287e-10080.39Expansin-A9 OS=Arabidopsis thaliana GN=EXPA9 PE=2 ... [more]
EXPA7_ORYSJ2.438e-9580.40Expansin-A7 OS=Oryza sativa subsp. japonica GN=EXP... [more]
EXP16_ARATH1.024e-9376.35Expansin-A16 OS=Arabidopsis thaliana GN=EXPA16 PE=... [more]
EXP15_ARATH7.613e-8171.57Expansin-A15 OS=Arabidopsis thaliana GN=EXPA15 PE=... [more]
EXPA1_ARATH1.875e-7973.48Expansin-A1 OS=Arabidopsis thaliana GN=EXPA1 PE=2 ... [more]
EXP10_ARATH5.456e-7973.74Expansin-A10 OS=Arabidopsis thaliana GN=EXPA10 PE=... [more]
EXPA2_ORYSJ7.126e-7973.60Expansin-A2 OS=Oryza sativa subsp. japonica GN=EXP... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32009A09EF RVDevelop1 Citrus clementina cDNA clone C32009A09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920488 ID=FC920488|Name=FC920488|organism=Citrus clementina|type=EST|length=695bp
GATTCGCCACCTCCTGCGCGCTCACTCACTCACTCACTCAACTCTCTGTC
TCCCTCTCTTCAACTCCAACAATGGCTCTTTTCAGAATGCTCTGCTTTTT
CTCAGTGGCACTCTCCTTATTTGCGACGGCCAACGCCAAGATTCCCGGTG
TCTTCGCCGGTGGCCCCTGGCAATCGGCCCACGCCACTTTTTACGGTGGC
AGCGACGCTTCCGGCACTATGGGTGGTGCTTGTGGGTACGGGAATCTGTA
CAGCCAGGGCTATGGAGTGAACACGGCGGCTCTCAGTACGGCGCTGTTCA
ACAACGGCTTGAGCTGCGGCGCGTGCTTCGAGTTAAAGTGCGGCGGCGAC
CCGCAATGGTGTAACCCGGGTAACCCGGCCATTCTGATCACGGCGACCAA
CTTTTGCCCCCCGAACTTCGCTCAGCCCTCCGATAATGGCGGGTGGTGCA
ACCCTCCTCGCCCTCATTTCGATCTGGCCATGCCTATGTTCCTCAAGCTC
GCCCAGTACCGCGCTGGTATCGTCCCCGTTTCTTACCGCAGGGTGCCCTG
CAGAAAGCGAGGCGGAATCAGATTCACAATTAACGGTTTCCGTTACTTCA
ACTTGGTCTTGGTCACCAACGTCGCGGGCGCAGGGGATATCGTGCGCGTG
AGCGTGAAAGGGGCCAACACCCAATGGCTGAGCATGAGCCGCAAC
back to top