FC920489

Overview
NameFC920489
Unique NameFC920489
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length732
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig11415 contig Ccv1_Contig11415:1..731. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920489 vs. ExPASy Swiss-Prot
Match: PSD7_ARATH (Probable 26S proteasome non-ATPase regulatory subunit 7 OS=Arabidopsis thaliana GN=RPN8 PE=2 SV=1)

HSP 1 Score: 366.696 bits (940), Expect = 7.210e-101
Identity = 181/203 (89.16%), Postives = 191/203 (94.09%), Query Frame = 2
Query:   98 MDVIKTQQISSRPIEKVIVHPLVLLSIVDNYNRVAKDTRKRVVGVLLGSSFKGTVDVSNSYAVPFEEDDKDPGIWFLDHNYHESMYSMFKRINAKEHVVGWYSTGPKLRENDLDIHQLFHNYVPNPVLVIIDVQPKELGIPTKAYYDVEEVKENATQKSQKVFVHVPSEIAAHEVEEIGVEHLLRDVKDTTISTLANEVTGKL 706
            MDVIKTQQIS+R IEKV+VHPLVLLSIVD+YNRVAKD+ KRVVGVLLGSS +G VDV+NSYAVPFEEDDKDP IWFLDHNYHESM+ MFKRINAKEHVVGWYSTGPKLRENDLD+H LF+ YVPNPVLVIIDVQPKELGIPTKAYY VEEVKENATQKSQKVFVHV +EIAAHEVEEIGVEHLLRDVKDTTISTLA EVT KL
Sbjct:    1 MDVIKTQQISARTIEKVVVHPLVLLSIVDHYNRVAKDSSKRVVGVLLGSSSRGVVDVTNSYAVPFEEDDKDPSIWFLDHNYHESMFHMFKRINAKEHVVGWYSTGPKLRENDLDVHALFNGYVPNPVLVIIDVQPKELGIPTKAYYAVEEVKENATQKSQKVFVHVSTEIAAHEVEEIGVEHLLRDVKDTTISTLATEVTAKL 203          
BLAST of FC920489 vs. ExPASy Swiss-Prot
Match: PSD7_DICDI (26S proteasome non-ATPase regulatory subunit 7 OS=Dictyostelium discoideum GN=psmD7 PE=3 SV=1)

HSP 1 Score: 258.84 bits (660), Expect = 2.117e-68
Identity = 121/185 (65.41%), Postives = 153/185 (82.70%), Query Frame = 2
Query:  149 IVHPLVLLSIVDNYNRVAKDTRKRVVGVLLGSSFKGTVDVSNSYAVPFEEDDKDPGIWFLDHNYHESMYSMFKRINAKEHVVGWYSTGPKLRENDLDIHQLFHNYVPNPVLVIIDVQPKELGIPTKAYYDVEEVKENATQKSQKVFVHVPSEIAAHEVEEIGVEHLLRDVKDTTISTLANEVTGK 703
            IVHP VLLS+VD+YNRVAKDT KRVVG LLGS+ KG VDVSN Y +PFEED+ +P IWFLDHN+HE+M++MFK+INA+E+VVGWYSTGPK+R  D DI++LF  Y PNPV+VIIDV PKELGIPTK+Y  VEE+ ++ ++ + + F H+PS I A E EEI +EHLLRDVKD++IS+L  ++T K
Sbjct:    9 IVHPTVLLSVVDHYNRVAKDTNKRVVGALLGSNNKGVVDVSNCYGLPFEEDEANPNIWFLDHNFHENMFAMFKKINARENVVGWYSTGPKIRPADQDINELFRRYTPNPVMVIIDVAPKELGIPTKSYVTVEEINKDTSESTMR-FQHIPSSIDAVEAEEICIEHLLRDVKDSSISSLTTQITDK 192          
BLAST of FC920489 vs. ExPASy Swiss-Prot
Match: PSD7_MOUSE (26S proteasome non-ATPase regulatory subunit 7 OS=Mus musculus GN=Psmd7 PE=1 SV=2)

HSP 1 Score: 249.98 bits (637), Expect = 9.836e-66
Identity = 118/191 (61.78%), Postives = 153/191 (80.10%), Query Frame = 2
Query:  137 IEKVIVHPLVLLSIVDNYNRVAK-DTRKRVVGVLLGSSFKGTVDVSNSYAVPFEEDDKDPGIWFLDHNYHESMYSMFKRINAKEHVVGWYSTGPKLRENDLDIHQLFHNYVPNPVLVIIDVQPKELGIPTKAYYDVEEVKENATQKSQKVFVHVPSEIAAHEVEEIGVEHLLRDVKDTTISTLANEVTGKL 706
            ++KV+VHPLVLLS+VD++NR+ K   +KRVVGVLLGS  K  +DVSNS+AVPF+EDDKD  +WFLDH+Y E+MY MFK++NA+E +VGWY TGPKL +ND+ I++L   Y PN VLVIIDV+PK+LG+PT+AY  VEEV ++ T  S K F HV SEI A E EE+GVEHLLRD+KDTT+ TL+  +T ++
Sbjct:    6 VQKVVVHPLVLLSVVDHFNRIGKVGNQKRVVGVLLGSWQKKVLDVSNSFAVPFDEDDKDDSVWFLDHDYLENMYGMFKKVNARERIVGWYHTGPKLHKNDIAINELMKRYCPNSVLVIIDVKPKDLGLPTEAYISVEEVHDDGTPTS-KTFEHVTSEIGAEEAEEVGVEHLLRDIKDTTVGTLSQRITNQV 195          
BLAST of FC920489 vs. ExPASy Swiss-Prot
Match: PSD7_HUMAN (26S proteasome non-ATPase regulatory subunit 7 OS=Homo sapiens GN=PSMD7 PE=1 SV=2)

HSP 1 Score: 249.98 bits (637), Expect = 9.836e-66
Identity = 118/191 (61.78%), Postives = 153/191 (80.10%), Query Frame = 2
Query:  137 IEKVIVHPLVLLSIVDNYNRVAK-DTRKRVVGVLLGSSFKGTVDVSNSYAVPFEEDDKDPGIWFLDHNYHESMYSMFKRINAKEHVVGWYSTGPKLRENDLDIHQLFHNYVPNPVLVIIDVQPKELGIPTKAYYDVEEVKENATQKSQKVFVHVPSEIAAHEVEEIGVEHLLRDVKDTTISTLANEVTGKL 706
            ++KV+VHPLVLLS+VD++NR+ K   +KRVVGVLLGS  K  +DVSNS+AVPF+EDDKD  +WFLDH+Y E+MY MFK++NA+E +VGWY TGPKL +ND+ I++L   Y PN VLVIIDV+PK+LG+PT+AY  VEEV ++ T  S K F HV SEI A E EE+GVEHLLRD+KDTT+ TL+  +T ++
Sbjct:    6 VQKVVVHPLVLLSVVDHFNRIGKVGNQKRVVGVLLGSWQKKVLDVSNSFAVPFDEDDKDDSVWFLDHDYLENMYGMFKKVNARERIVGWYHTGPKLHKNDIAINELMKRYCPNSVLVIIDVKPKDLGLPTEAYISVEEVHDDGTPTS-KTFEHVTSEIGAEEAEEVGVEHLLRDIKDTTVGTLSQRITNQV 195          
BLAST of FC920489 vs. ExPASy Swiss-Prot
Match: PSD7_BOVIN (26S proteasome non-ATPase regulatory subunit 7 OS=Bos taurus GN=PSMD7 PE=2 SV=1)

HSP 1 Score: 249.98 bits (637), Expect = 9.836e-66
Identity = 118/191 (61.78%), Postives = 153/191 (80.10%), Query Frame = 2
Query:  137 IEKVIVHPLVLLSIVDNYNRVAK-DTRKRVVGVLLGSSFKGTVDVSNSYAVPFEEDDKDPGIWFLDHNYHESMYSMFKRINAKEHVVGWYSTGPKLRENDLDIHQLFHNYVPNPVLVIIDVQPKELGIPTKAYYDVEEVKENATQKSQKVFVHVPSEIAAHEVEEIGVEHLLRDVKDTTISTLANEVTGKL 706
            ++KV+VHPLVLLS+VD++NR+ K   +KRVVGVLLGS  K  +DVSNS+AVPF+EDDKD  +WFLDH+Y E+MY MFK++NA+E +VGWY TGPKL +ND+ I++L   Y PN VLVIIDV+PK+LG+PT+AY  VEEV ++ T  S K F HV SEI A E EE+GVEHLLRD+KDTT+ TL+  +T ++
Sbjct:    6 VQKVVVHPLVLLSVVDHFNRIGKVGNQKRVVGVLLGSWQKKVLDVSNSFAVPFDEDDKDDSVWFLDHDYLENMYGMFKKVNARERIVGWYHTGPKLHKNDIAINELMKRYCPNSVLVIIDVKPKDLGLPTEAYISVEEVHDDGTPTS-KTFEHVTSEIGAEEAEEVGVEHLLRDIKDTTVGTLSQRITNQV 195          
BLAST of FC920489 vs. ExPASy Swiss-Prot
Match: PSD7_DROME (26S proteasome non-ATPase regulatory subunit 7 OS=Drosophila melanogaster GN=Mov34 PE=1 SV=6)

HSP 1 Score: 247.669 bits (631), Expect = 4.882e-65
Identity = 121/200 (60.50%), Postives = 158/200 (79.00%), Query Frame = 2
Query:  113 TQQISSRPIEKVIVHPLVLLSIVDNYNRVAK-DTRKRVVGVLLGS-SFKGTVDVSNSYAVPFEEDDKDPGIWFLDHNYHESMYSMFKRINAKEHVVGWYSTGPKLRENDLDIHQLFHNYVPNPVLVIIDVQPKELGIPTKAYYDVEEVKENATQKSQKVFVHVPSEIAAHEVEEIGVEHLLRDVKDTTISTLANEVTGKL 706
            +Q++S   + KVIVHPLVLLS+VD++NR+ K   +KRVVGVLLG    KG +DVSNS+AVPF+EDDKD  +WFLDH+Y E+MY MFK++NA+E VVGWY TGPKL +ND+ I++L   Y PN VLVIID +PK+LG+PT+AY  VEEV ++ +  S K F HVPSEI A E EE+GVEHLLRD+KDTT+ +L+ ++T +L
Sbjct:    3 SQEVS---VNKVIVHPLVLLSVVDHFNRMGKIGNQKRVVGVLLGCWRSKGVLDVSNSFAVPFDEDDKDKSVWFLDHDYLENMYGMFKKVNARERVVGWYHTGPKLHQNDIAINELVRRYCPNSVLVIIDAKPKDLGLPTEAYISVEEVHDDGSPTS-KTFEHVPSEIGAEEAEEVGVEHLLRDIKDTTVGSLSQKITNQL 198          
BLAST of FC920489 vs. ExPASy Swiss-Prot
Match: RPN8_SCHPO (26S proteasome regulatory subunit rpn8 OS=Schizosaccharomyces pombe GN=rpn8 PE=2 SV=1)

HSP 1 Score: 243.817 bits (621), Expect = 7.049e-64
Identity = 113/190 (59.47%), Postives = 151/190 (79.47%), Query Frame = 2
Query:  140 EKVIVHPLVLLSIVDNYNRVAKDTRKRVVGVLLGSSFKGTVDVSNSYAVPFEEDDKDPGIWFLDHNYHESMYSMFKRINAKEHVVGWYSTGPKLRENDLDIHQLFHNYVPNPVLVIIDVQPKELGIPTKAYYDVEEVKENATQKSQKVFVHVPSEIAAHEVEEIGVEHLLRDVKDTTISTLANEVTGKLQ 709
            ++VIVHPLVLLS VD+YNR AK T++RVVG+LLG +    V+V+NSYA+PFEED+K+  +WFLDHN+ ESM  MFK+INA E +VGWY TGP+LR +DL+I+ L   Y+PNPVLVIIDV+PK +G+PT AY+ ++E++++ + KS + FVH+PS I A E EEIGVEHLLRD +D ++ TLA  VT + Q
Sbjct:   15 QQVIVHPLVLLSAVDSYNRSAKGTKRRVVGILLGQNNGDVVNVANSYAIPFEEDEKNASVWFLDHNFMESMNEMFKKINANEKLVGWYHTGPQLRPSDLEINNLLKKYIPNPVLVIIDVKPKSVGLPTNAYFAIDEIEDDGS-KSSRTFVHLPSSIEAEEAEEIGVEHLLRDTRDASVGTLATRVTQQAQ 203          
BLAST of FC920489 vs. ExPASy Swiss-Prot
Match: RPN8_NEUCR (26S proteasome regulatory subunit rpn-8 OS=Neurospora crassa GN=rpn-8 PE=3 SV=1)

HSP 1 Score: 241.121 bits (614), Expect = 4.569e-63
Identity = 116/190 (61.05%), Postives = 146/190 (76.84%), Query Frame = 2
Query:  146 VIVHPLVLLSIVDNYNRVA--KDTRKRVVGVLLGSSFKGTVDVSNSYAVPFEEDDKDPGIWFLDHNYHESMYSMFKRINAKEHVVGWYSTGPKLRENDLDIHQLFHNYVPNPVLVIIDVQPKELGIPTKAYYDVEEVKENATQKSQKVFVHVPSEIAAHEVEEIGVEHLLRDVKDTTISTLANEVTGKLQ 709
            V V PLVLLS+VD+YNR    K   KRVVGVLLG +    V VSNS+AVPFEEDDKDP +WFLDHNY ESM  MFK++NA+E ++GWY +GPKLR +DLDI++LF  Y PNP+LVI+DVQPKE G+PT AY+ V+E+K++ T  S K FVH PS I A E EEIGVEHLLRD++D  + TL+  +T +++
Sbjct:   16 VSVAPLVLLSVVDHYNRTQANKSKSKRVVGVLLGQNDGKNVRVSNSFAVPFEEDDKDPSVWFLDHNYVESMNDMFKKVNAREKLIGWYHSGPKLRASDLDINELFKRYTPNPLLVIVDVQPKETGVPTDAYFAVDEIKDDGTTTS-KTFVHTPSIIEAEEAEEIGVEHLLRDIRDVAVGTLSTRITNQMR 204          
BLAST of FC920489 vs. ExPASy Swiss-Prot
Match: RPN8_CANGA (26S proteasome regulatory subunit RPN8 OS=Candida glabrata GN=RPN8 PE=3 SV=1)

HSP 1 Score: 203.371 bits (516), Expect = 1.056e-51
Identity = 98/191 (51.31%), Postives = 139/191 (72.77%), Query Frame = 2
Query:  140 EKVIVHPLVLLSIVDNYNRVAKDTRKRVVGVLLGSSFKGTVDVSNSYAVPFEEDDKDPGIWFLDHNYHESMYSMFKRINAKEHVVGWYSTGPKLRENDLDIHQLFHNYVP-NPVLVIIDVQPKELGIPTKAYYDVEEVKENATQKSQKVFVHVPSEIAAHEVEEIGVEHLLRDVKDTTISTLANEVTGKLQ 709
            + V + PLVLLS++D+Y R      KR VGV+LG S   T+ V+NS+A+PFEED+K+  +WFLDHNY ESM  M K+INAKE ++GWY +GPKLR +DL I++LF  Y   NP+L+I+DV+ +++G+PT AY  VE+VK++ T  ++K F+H+P  + A E EEIGVEHLLRDV+D     L+  +T +L+
Sbjct:    6 DNVTIAPLVLLSVLDHYERTNTPEGKRCVGVILGDSQTNTIRVTNSFALPFEEDEKNSDVWFLDHNYIESMNEMCKKINAKEKLIGWYHSGPKLRASDLKINELFKKYTQGNPLLLIVDVKQQDVGLPTDAYMAVEQVKDDGT-STEKTFLHLPCTVEAEEAEEIGVEHLLRDVRDQAAGGLSIRLTNQLK 195          
BLAST of FC920489 vs. ExPASy Swiss-Prot
Match: RPN8_ASHGO (26S proteasome regulatory subunit RPN8 OS=Ashbya gossypii GN=RPN8 PE=3 SV=1)

HSP 1 Score: 202.986 bits (515), Expect = 1.379e-51
Identity = 99/191 (51.83%), Postives = 140/191 (73.30%), Query Frame = 2
Query:  140 EKVIVHPLVLLSIVDNYNRVAKDTRKRVVGVLLGSSFKGTVDVSNSYAVPFEEDDKDPGIWFLDHNYHESMYSMFKRINAKEHVVGWYSTGPKLRENDLDIHQLFHNYVP-NPVLVIIDVQPKELGIPTKAYYDVEEVKENATQKSQKVFVHVPSEIAAHEVEEIGVEHLLRDVKDTTISTLANEVTGKLQ 709
            E+V V PLVLLS++D+Y R+     KR VGVLLG +   T+ V+NS+A+PFEED+K+P +WFLDHNY E+M  M K+INAKE ++GWY +GPKLR +DL I+ LF  Y   N +L+I+DV+ + +G+PT AY  +EEVK++ +  +++ FVH+P+ I A E EEIGVEHLLRDV+D     L+  +T +L+
Sbjct:    6 EQVNVAPLVLLSVLDHYKRMNTPDNKRCVGVLLGDNSGSTIKVTNSFALPFEEDEKNPDVWFLDHNYIENMNDMCKKINAKEKMIGWYHSGPKLRSSDLKINGLFKKYTQGNSLLLIVDVKQQGVGLPTDAYMAIEEVKDDGS-STERTFVHLPTAIEAEEAEEIGVEHLLRDVRDQAAGNLSLRLTNQLK 195          
The following BLAST results are available for this feature:
BLAST of FC920489 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 46
Match NameE-valueIdentityDescription
PSD7_ARATH7.210e-10189.16Probable 26S proteasome non-ATPase regulatory subu... [more]
PSD7_DICDI2.117e-6865.4126S proteasome non-ATPase regulatory subunit 7 OS=... [more]
PSD7_MOUSE9.836e-6661.7826S proteasome non-ATPase regulatory subunit 7 OS=... [more]
PSD7_HUMAN9.836e-6661.7826S proteasome non-ATPase regulatory subunit 7 OS=... [more]
PSD7_BOVIN9.836e-6661.7826S proteasome non-ATPase regulatory subunit 7 OS=... [more]
PSD7_DROME4.882e-6560.5026S proteasome non-ATPase regulatory subunit 7 OS=... [more]
RPN8_SCHPO7.049e-6459.4726S proteasome regulatory subunit rpn8 OS=Schizosa... [more]
RPN8_NEUCR4.569e-6361.0526S proteasome regulatory subunit rpn-8 OS=Neurosp... [more]
RPN8_CANGA1.056e-5151.3126S proteasome regulatory subunit RPN8 OS=Candida ... [more]
RPN8_ASHGO1.379e-5151.8326S proteasome regulatory subunit RPN8 OS=Ashbya g... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32009A11EF RVDevelop1 Citrus clementina cDNA clone C32009A11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920489 ID=FC920489|Name=FC920489|organism=Citrus clementina|type=EST|length=732bp
GGTCAACAAAGCCATAAAAAGAAAAATCAACTGAGAAGGGGTTTTAAGTA
CAGACTACAGAGAGCAAAAGTGACAACAAACACAGAGAGATTCGAATATG
GACGTGATAAAGACGCAGCAAATTTCATCGAGACCCATAGAGAAGGTCAT
AGTTCACCCGCTCGTCTTACTAAGCATCGTCGACAATTACAACCGCGTCG
CCAAGGACACGCGCAAGCGCGTCGTCGGCGTCCTCCTCGGTAGCTCCTTC
AAAGGCACCGTCGATGTCTCCAACAGCTACGCAGTGCCTTTTGAGGAAGA
TGACAAAGACCCAGGAATATGGTTTCTCGACCACAACTACCATGAATCAA
TGTATTCAATGTTCAAAAGAATCAATGCCAAGGAGCATGTCGTAGGTTGG
TACAGTACAGGACCCAAGCTACGAGAGAATGATCTTGACATTCACCAATT
ATTTCACAACTATGTCCCAAATCCTGTATTGGTCATTATTGATGTCCAAC
CAAAGGAGCTTGGAATACCCACCAAGGCTTACTATGATGTTGAGGAGGTT
AAAGAGAATGCTACTCAGAAAAGCCAAAAGGTCTTTGTACACGTGCCATC
AGAAATTGCCGCTCATGAAGTCGAAGAAATCGGAGTGGAGCACTTGCTAA
GGGACGTGAAAGACACCACCATCAGTACACTTGCAAATGAGGTCACTGGA
AAACTACAGCCCTAAGGGTCTGGATGCTCGTT
back to top