FC920492

Overview
NameFC920492
Unique NameFC920492
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length704
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15544 contig Ccv1_Contig15544:86..789. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920492 vs. ExPASy Swiss-Prot
Match: AAT3_ARATH (Aspartate aminotransferase, chloroplastic OS=Arabidopsis thaliana GN=ASP3 PE=1 SV=1)

HSP 1 Score: 384.03 bits (985), Expect = 4.111e-106
Identity = 183/212 (86.32%), Postives = 202/212 (95.28%), Query Frame = 3
Query:   69 SVFGKIVRAPEDPILGVTVAYNKDTSPVKLNLGVGAYRTEEGKPLVLNVVRKAEQLLVNDQSRVKEYLPIVGLVDFNKLSAKLILGADSPAIKDNRVTTVQCLSGTGSLRVGAEFLARHYHQLTIYIPQPTWGNHPKVFTLAGLSVKTYRYYDPATRGLNFQGLLEDLRAAPSGAIVLLHACAHNPTGVDPTLEQWEQIRQLMRSKGLLPFF 704
            SVF  +V+APEDPILGVTVAYNKD SPVKLNLGVGAYRTEEGKPLVLNVVRKAEQ L+ND++R+KEYLPIVGLV+FNKLSAKLILGADSPAI++NR+TTV+CLSGTGSLRVG EFLA+HYHQ TIYI QPTWGNHPK+FTLAGL+VKTYRYYDPATRGLNFQGLLEDL AA  G+IVLLHACAHNPTGVDPT++QWEQIR+LMRSKGL+PFF
Sbjct:   47 SVFSHLVQAPEDPILGVTVAYNKDPSPVKLNLGVGAYRTEEGKPLVLNVVRKAEQQLINDRTRIKEYLPIVGLVEFNKLSAKLILGADSPAIRENRITTVECLSGTGSLRVGGEFLAKHYHQKTIYITQPTWGNHPKIFTLAGLTVKTYRYYDPATRGLNFQGLLEDLGAAAPGSIVLLHACAHNPTGVDPTIQQWEQIRKLMRSKGLMPFF 258          
BLAST of FC920492 vs. ExPASy Swiss-Prot
Match: AATC_ORYSJ (Aspartate aminotransferase, cytoplasmic OS=Oryza sativa subsp. japonica GN=Os01g0760600 PE=2 SV=1)

HSP 1 Score: 383.645 bits (984), Expect = 5.369e-106
Identity = 185/216 (85.65%), Postives = 201/216 (93.06%), Query Frame = 3
Query:   57 MDSESVFGKIVRAPEDPILGVTVAYNKDTSPVKLNLGVGAYRTEEGKPLVLNVVRKAEQLLVNDQSRVKEYLPIVGLVDFNKLSAKLILGADSPAIKDNRVTTVQCLSGTGSLRVGAEFLARHYHQLTIYIPQPTWGNHPKVFTLAGLSVKTYRYYDPATRGLNFQGLLEDLRAAPSGAIVLLHACAHNPTGVDPTLEQWEQIRQLMRSKGLLPFF 704
            M S SVF  + +APEDPILGVTVAYNKD SPVK+NLGVGAYRTEEGKPLVLNVVR+AEQ+L+N+ SRVKEYLPI GL DFNKLSAKLI GADSPAI++NRV TVQCLSGTGSLRVG EFLARHYH+ TIYIPQPTWGNHPKVFTLAGL+V++YRYYDPATRGL+FQGLLEDL +APSGAIVLLHACAHNPTGVDPTL+QWEQIRQLMRSK LLPFF
Sbjct:    1 MASSSVFAGLAQAPEDPILGVTVAYNKDPSPVKVNLGVGAYRTEEGKPLVLNVVRRAEQMLINNPSRVKEYLPITGLADFNKLSAKLIFGADSPAIQENRVATVQCLSGTGSLRVGGEFLARHYHERTIYIPQPTWGNHPKVFTLAGLTVRSYRYYDPATRGLDFQGLLEDLGSAPSGAIVLLHACAHNPTGVDPTLDQWEQIRQLMRSKALLPFF 216          
BLAST of FC920492 vs. ExPASy Swiss-Prot
Match: AATC_DAUCA (Aspartate aminotransferase, cytoplasmic OS=Daucus carota PE=2 SV=1)

HSP 1 Score: 382.874 bits (982), Expect = 9.158e-106
Identity = 184/212 (86.79%), Postives = 199/212 (93.87%), Query Frame = 3
Query:   69 SVFGKIVRAPEDPILGVTVAYNKDTSPVKLNLGVGAYRTEEGKPLVLNVVRKAEQLLVNDQSRVKEYLPIVGLVDFNKLSAKLILGADSPAIKDNRVTTVQCLSGTGSLRVGAEFLARHYHQLTIYIPQPTWGNHPKVFTLAGLSVKTYRYYDPATRGLNFQGLLEDLRAAPSGAIVLLHACAHNPTGVDPTLEQWEQIRQLMRSKGLLPFF 704
            SVF  +VRAPEDPILGVTVAY+KD SP KLNLGVGAYRTEEGKPLVLNVV+KAEQ+LVNDQSRVKEYLPIVGL DFNKLSAKLI GADSPAI++NRV TVQCLSGTGSLRVG EFLARHYH+ T+YIPQPTWGNHPK+FTLAGLSVKTYRYY+P TRGL+F+G+LEDL +AP GAIVLLHACAHNPTGVDPT+EQWEQIRQLMRSK LLPFF
Sbjct:    3 SVFANVVRAPEDPILGVTVAYHKDQSPNKLNLGVGAYRTEEGKPLVLNVVKKAEQMLVNDQSRVKEYLPIVGLADFNKLSAKLIFGADSPAIQENRVATVQCLSGTGSLRVGGEFLARHYHEHTVYIPQPTWGNHPKIFTLAGLSVKTYRYYNPETRGLDFEGMLEDLGSAPLGAIVLLHACAHNPTGVDPTIEQWEQIRQLMRSKSLLPFF 214          
BLAST of FC920492 vs. ExPASy Swiss-Prot
Match: AAT2_ARATH (Aspartate aminotransferase, cytoplasmic isozyme 1 OS=Arabidopsis thaliana GN=ASP2 PE=1 SV=2)

HSP 1 Score: 372.474 bits (955), Expect = 1.238e-102
Identity = 182/213 (85.45%), Postives = 195/213 (91.55%), Query Frame = 3
Query:   66 ESVFGKIVRAPEDPILGVTVAYNKDTSPVKLNLGVGAYRTEEGKPLVLNVVRKAEQLLVNDQSRVKEYLPIVGLVDFNKLSAKLILGADSPAIKDNRVTTVQCLSGTGSLRVGAEFLARHYHQLTIYIPQPTWGNHPKVFTLAGLSVKTYRYYDPATRGLNFQGLLEDLRAAPSGAIVLLHACAHNPTGVDPTLEQWEQIRQLMRSKGLLPFF 704
            +SVF  + RAPEDPILGVTVAYN D SPVK+NLGVGAYRTEEGKPLVL+VVRKAEQ LVND SRVKEY+PIVG+ DFNKLSAKLILGADSPAI ++RVTTVQCLSGTGSLRVGAEFL  HYHQ  IYIP+PTWGNHPKVF LAGLSV+ +RYYDPATRGL+F+GLLEDL AAPSGAIVLLHACAHNPTGVDPT EQWEQIRQLMRSK LLPFF
Sbjct:    2 DSVFSNVARAPEDPILGVTVAYNNDPSPVKINLGVGAYRTEEGKPLVLDVVRKAEQQLVNDPSRVKEYIPIVGISDFNKLSAKLILGADSPAITESRVTTVQCLSGTGSLRVGAEFLKTHYHQSVIYIPKPTWGNHPKVFNLAGLSVEYFRYYDPATRGLDFKGLLEDLGAAPSGAIVLLHACAHNPTGVDPTSEQWEQIRQLMRSKSLLPFF 214          
BLAST of FC920492 vs. ExPASy Swiss-Prot
Match: AAT1_MEDSA (Aspartate aminotransferase 1 OS=Medicago sativa GN=AAT-1 PE=2 SV=2)

HSP 1 Score: 365.155 bits (936), Expect = 1.976e-100
Identity = 177/214 (82.71%), Postives = 195/214 (91.12%), Query Frame = 3
Query:   63 SESVFGKIVRAPEDPILGVTVAYNKDTSPVKLNLGVGAYRTEEGKPLVLNVVRKAEQLLVNDQSRVKEYLPIVGLVDFNKLSAKLILGADSPAIKDNRVTTVQCLSGTGSLRVGAEFLARHYHQLTIYIPQPTWGNHPKVFTLAGLSVKTYRYYDPATRGLNFQGLLEDLRAAPSGAIVLLHACAHNPTGVDPTLEQWEQIRQLMRSKGLLPFF 704
            S+SVF  +VRAPEDPILGVTVAYNKD SP+KLNLGVGAYRTEEGKPLVL+VVR+ E+ L+ND SR KEY+PIVGL DFNKLSAKLI GADSPAI++NRVTTVQ LSGTGSLRVG EFLA+HYHQ  IY+P PTWGNH KVF LAGL+VKTYRYY PATRGL+FQGLLEDL +APSG++VLLHACAHNPTGVDPTLEQWEQIRQL+RSK LLPFF
Sbjct:   14 SDSVFAHLVRAPEDPILGVTVAYNKDPSPIKLNLGVGAYRTEEGKPLVLDVVRRVERQLLNDMSRNKEYIPIVGLADFNKLSAKLIFGADSPAIQENRVTTVQGLSGTGSLRVGGEFLAKHYHQRIIYLPTPTWGNHTKVFNLAGLTVKTYRYYAPATRGLDFQGLLEDLGSAPSGSVVLLHACAHNPTGVDPTLEQWEQIRQLIRSKSLLPFF 227          
BLAST of FC920492 vs. ExPASy Swiss-Prot
Match: AAT4_ARATH (Aspartate aminotransferase, cytoplasmic isozyme 2 OS=Arabidopsis thaliana GN=ASP4 PE=2 SV=2)

HSP 1 Score: 306.22 bits (783), Expect = 1.089e-82
Identity = 148/212 (69.81%), Postives = 173/212 (81.60%), Query Frame = 3
Query:   69 SVFGKIVRAPEDPILGVTVAYNKDTSPVKLNLGVGAYRTEEGKPLVLNVVRKAEQLLVNDQSRVKEYLPIVGLVDFNKLSAKLILGADSPAIKDNRVTTVQCLSGTGSLRVGAEFLARHYHQLTIYIPQPTWGNHPKVFTLAGLSVKTYRYYDPATRGLNFQGLLEDLRAAPSGAIVLLHACAHNPTGVDPTLEQWEQIRQLMRSKGLLPFF 704
            S+   ++ APEDP+L V  A   D SPVKLNL  G YRTEEGKPLVL+VVR+AEQ L ND    KEYLP+ GL +FNKLS KLILG DSPA+K+NRV T QCLSGTGSLRVGAEFLA H  +  I++P PTWGNHP++FTLAGLSV+ +RYYDP +RGL+F+G+LEDL AAP GAIV+L ACAHNPTGVDPT EQWE+IR+L+RSK LLPFF
Sbjct:    3 SILSSVLPAPEDPVLSVIFACRDDPSPVKLNLSAGTYRTEEGKPLVLDVVRRAEQQLANDLD--KEYLPLNGLPEFNKLSTKLILGDDSPALKENRVVTTQCLSGTGSLRVGAEFLATHNKESVIFVPNPTWGNHPRIFTLAGLSVQYFRYYDPKSRGLDFKGMLEDLGAAPPGAIVVLQACAHNPTGVDPTFEQWEKIRRLVRSKSLLPFF 212          
BLAST of FC920492 vs. ExPASy Swiss-Prot
Match: AATM_DICDI (Aspartate aminotransferase, mitochondrial OS=Dictyostelium discoideum GN=aatA PE=3 SV=1)

HSP 1 Score: 245.358 bits (625), Expect = 2.282e-64
Identity = 115/219 (52.51%), Postives = 158/219 (72.15%), Query Frame = 3
Query:   48 RNLMDSESVFGKIVRAPEDPILGVTVAYNKDTSPVKLNLGVGAYRTEEGKPLVLNVVRKAEQLLVNDQSRVKEYLPIVGLVDFNKLSAKLILGADSPAIKDNRVTTVQCLSGTGSLRVGAEFLARHYHQLTIYIPQPTWGNHPKVFTLAGLSVKTYRYYDPATRGLNFQGLLEDLRAAPSGAIVLLHACAHNPTGVDPTLEQWEQIRQLMRSKGLLPFF 704
            R    + + +  + + PEDPILGV++AYNKDTSP K+NLGVGAYR E GKP VL+ V+KA++ +  + +   EY PIVG+  FN+L+A+L LG +   IK+ R+ TVQ +SGTG+LR+ A+F AR     T Y+P PTWGNH  +F  AG+ VK+Y YY+PAT GLNF+ + +D+ AAP G+I+LLHACAHNPTGVDPT EQW++I ++ + +G    F
Sbjct:   19 RQFSTNTNWWANVQKGPEDPILGVSIAYNKDTSPSKINLGVGAYRDENGKPYVLDCVKKADKKIY-EANVDHEYAPIVGVAAFNQLAAQLALGEECKHIKEKRIATVQSISGTGALRIAADFFARFLKGKTAYVPNPTWGNHNVIFNDAGIPVKSYGYYNPATCGLNFEAMTKDIAAAPEGSIILLHACAHNPTGVDPTAEQWKKISEICKERGHFVLF 236          
BLAST of FC920492 vs. ExPASy Swiss-Prot
Match: AATM_LUPAN (Aspartate aminotransferase P2, mitochondrial (Fragment) OS=Lupinus angustifolius PE=2 SV=1)

HSP 1 Score: 244.973 bits (624), Expect = 2.980e-64
Identity = 122/212 (57.55%), Postives = 153/212 (72.17%), Query Frame = 3
Query:   69 SVFGKIVRAPEDPILGVTVAYNKDTSPVKLNLGVGAYRTEEGKPLVLNVVRKAEQLLVNDQSRVKEYLPIVGLVDFNKLSAKLILGADSPAIKDNRVTTVQCLSGTGSLRVGAEFLARHYHQLTIYIPQPTWGNHPKVFTLAGLSVKTYRYYDPATRGLNFQGLLEDLRAAPSGAIVLLHACAHNPTGVDPTLEQWEQIRQLMRSKGLLPFF 704
            S F  I  AP DPILGV+ A+  DTS  KLNLGVGAYRTEE +P VL VV KAE L++ ++ + KEYL I GL  FNK +A+L+LGAD+PAIK  RV TVQ LSGTGSLR+GA  + R++    + I  PTWGNH  +F  A +    YRYYDP T GL+F+G++ED++AAP G  VLLH CAHNPTG+DPT EQWE+I  +++ K  +PFF
Sbjct:   52 SRFEGIPMAPPDPILGVSEAFRADTSDAKLNLGVGAYRTEELQPYVLKVVNKAENLML-ERGQNKEYLAIEGLAAFNKATAELLLGADNPAIKQQRVATVQGLSGTGSLRLGAALIERYFPGAKVLISAPTWGNHKNIFNDARVPWSEYRYYDPKTVGLDFEGMIEDIKAAPEGTFVLLHGCAHNPTGIDPTPEQWEKIADVIQEKNHIPFF 262          
BLAST of FC920492 vs. ExPASy Swiss-Prot
Match: AAT5_ARATH (Aspartate aminotransferase, chloroplastic OS=Arabidopsis thaliana GN=ASP5 PE=1 SV=2)

HSP 1 Score: 234.572 bits (597), Expect = 4.028e-61
Identity = 114/212 (53.77%), Postives = 150/212 (70.75%), Query Frame = 3
Query:   69 SVFGKIVRAPEDPILGVTVAYNKDTSPVKLNLGVGAYRTEEGKPLVLNVVRKAEQLLVNDQSRVKEYLPIVGLVDFNKLSAKLILGADSPAIKDNRVTTVQCLSGTGSLRVGAEFLARHYHQLTIYIPQPTWGNHPKVFTLAGLSVKTYRYYDPATRGLNFQGLLEDLRAAPSGAIVLLHACAHNPTGVDPTLEQWEQIRQLMRSKGLLPFF 704
            S F  I  AP DPILGV+ A+  DT+ +KLNLGVGAYRTEE +P VLNVV+KAE L++ ++   KEYLPI GL  FNK +A+L+ GA  P IK+ RV T+Q LSGTGSLR+ A  + R++    + I  PTWGNH  +F  A +    YRYYDP T GL+F+G++ D++ AP G+ +LLH CAHNPTG+DPT EQW +I  +++ K  +PFF
Sbjct:   51 SRFEGITMAPPDPILGVSEAFKADTNGMKLNLGVGAYRTEELQPYVLNVVKKAENLML-ERGDNKEYLPIEGLAAFNKATAELLFGAGHPVIKEQRVATIQGLSGTGSLRLAAALIERYFPGAKVVISSPTWGNHKNIFNDAKVPWSEYRYYDPKTIGLDFEGMIADIKEAPEGSFILLHGCAHNPTGIDPTPEQWVKIADVIQEKNHIPFF 261          
BLAST of FC920492 vs. ExPASy Swiss-Prot
Match: AATM_XENTR (Aspartate aminotransferase, mitochondrial OS=Xenopus tropicalis GN=got2 PE=2 SV=1)

HSP 1 Score: 231.106 bits (588), Expect = 4.454e-60
Identity = 115/215 (53.49%), Postives = 150/215 (69.77%), Query Frame = 3
Query:   63 SESVFGKIVRAPEDPILGVTVAYNKDTSPVKLNLGVGAYRTEEGKPLVLNVVRKAEQLLVNDQSRVKEYLPIVGLVDFNKLSAKLILGADSPAIKDNRVTTVQCLSGTGSLRVGAEFLARHY-HQLTIYIPQPTWGNHPKVFTLAGLSVKTYRYYDPATRGLNFQGLLEDLRAAPSGAIVLLHACAHNPTGVDPTLEQWEQIRQLMRSKGLLPFF 704
            + S +  +   P DPILGVT A+ +DT+  K+NLGVGAYR + GKP VL+ VRKAE  L + ++  KEYLPI GL +F + SA+L LG +  AI+  R  TVQ +SGTGSLRVGA FL R Y +   +Y+P+P+WGNH  +F  AGL VK YRYYDP T G +F G L+D+   P  +I+L HACAHNPTGVDP  EQW+++  L++S+ L PFF
Sbjct:   26 ASSWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLSSVRKAEAQLAS-KNLDKEYLPIGGLAEFARASAQLALGENCDAIQSGRFITVQTISGTGSLRVGANFLQRFYKYSRDVYLPKPSWGNHTPIFRDAGLEVKGYRYYDPKTCGFDFTGALDDISKIPEQSIILFHACAHNPTGVDPKQEQWKELAALIKSRRLFPFF 239          
The following BLAST results are available for this feature:
BLAST of FC920492 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 50
Match NameE-valueIdentityDescription
AAT3_ARATH4.111e-10686.32Aspartate aminotransferase, chloroplastic OS=Arabi... [more]
AATC_ORYSJ5.369e-10685.65Aspartate aminotransferase, cytoplasmic OS=Oryza s... [more]
AATC_DAUCA9.158e-10686.79Aspartate aminotransferase, cytoplasmic OS=Daucus ... [more]
AAT2_ARATH1.238e-10285.45Aspartate aminotransferase, cytoplasmic isozyme 1 ... [more]
AAT1_MEDSA1.976e-10082.71Aspartate aminotransferase 1 OS=Medicago sativa GN... [more]
AAT4_ARATH1.089e-8269.81Aspartate aminotransferase, cytoplasmic isozyme 2 ... [more]
AATM_DICDI2.282e-6452.51Aspartate aminotransferase, mitochondrial OS=Dicty... [more]
AATM_LUPAN2.980e-6457.55Aspartate aminotransferase P2, mitochondrial (Frag... [more]
AAT5_ARATH4.028e-6153.77Aspartate aminotransferase, chloroplastic OS=Arabi... [more]
AATM_XENTR4.454e-6053.49Aspartate aminotransferase, mitochondrial OS=Xenop... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32009B02EF RVDevelop1 Citrus clementina cDNA clone C32009B02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920492 ID=FC920492|Name=FC920492|organism=Citrus clementina|type=EST|length=704bp
GATTTTTTTTTCCCCCACAAACTCTCTCTTTTCATTGATTTCTTGAAAGA
AATTTAATGGATTCTGAATCAGTGTTTGGAAAGATTGTTCGTGCTCCTGA
AGATCCCATTCTAGGGGTCACTGTTGCTTATAACAAGGATACAAGCCCAG
TCAAGTTGAACTTGGGTGTTGGTGCTTACCGAACTGAGGAAGGGAAACCT
CTGGTTCTGAATGTAGTGAGAAAGGCAGAGCAGCTCTTAGTGAATGACCA
GTCACGGGTCAAAGAGTATCTTCCCATTGTTGGACTTGTGGATTTTAATA
AATTGAGTGCAAAGCTCATCCTTGGTGCTGACAGCCCTGCGATTAAAGAC
AACAGAGTGACCACCGTTCAGTGCTTGTCTGGCACTGGTTCTTTGAGGGT
TGGAGCTGAGTTTCTGGCAAGGCATTATCACCAACTTACCATATATATTC
CACAGCCAACATGGGGAAACCATCCCAAAGTTTTCACTTTAGCAGGATTG
TCTGTGAAGACCTACCGCTATTATGATCCAGCAACACGTGGGCTAAACTT
CCAAGGCTTGCTGGAGGATCTTAGGGCTGCACCATCCGGAGCTATAGTTC
TTCTTCATGCATGTGCTCATAATCCAACTGGTGTTGACCCGACCCTTGAG
CAGTGGGAGCAGATCAGGCAGCTGATGAGGTCAAAAGGATTGTTACCTTT
CTTT
back to top