FC920495

Overview
NameFC920495
Unique NameFC920495
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length706
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14143 contig Ccv1_Contig14143:4..709. BLAST: Citrus Unigene V1 Contigs to SwissProt
Homology
BLAST of FC920495 vs. ExPASy Swiss-Prot
Match: RHLG_PSEAE (Rhamnolipids biosynthesis 3-oxoacyl-[acyl-carrier-protein] reductase OS=Pseudomonas aeruginosa GN=rhlG PE=1 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 5.933e-20
Identity = 53/135 (39.26%), Postives = 80/135 (59.26%), Query Frame = 1
Query:  295 LGTMMATALAQNGAKVIIASRKEKALKEVADELNGHSQGSCEYIVADLGTKAGCDFLASEVKKRTDKVHILINNSGVTWGAQFDKVPEKEGWDRVFALNVKSIFYLTSALTPLLAEGSDNLDPGRVINIXSVAGL 699
            +G M+A  L + GA+V I +R  +A  + A  L+ +  G C+ I ADL ++AG   LA  + + + ++ IL+NN+G +WGA  +  P   GW++V  LNV S+F     L PLL   +   +P RVINI SVAG+
Sbjct:   21 IGQMIAQGLLEAGARVFICARDAEACADTATRLSAY--GDCQAIPADLSSEAGARRLAQALGELSARLDILVNNAGTSWGAALESYPVS-GWEKVMQLNVTSVFSCIQQLLPLLRRSASAENPARVINIGSVAGI 152          
BLAST of FC920495 vs. ExPASy Swiss-Prot
Match: Y0419_STAS1 (Uncharacterized oxidoreductase SSP0419 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP0419 PE=3 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 6.575e-11
Identity = 37/136 (27.21%), Postives = 68/136 (50.00%), Query Frame = 1
Query:  295 LGTMMATALAQNGAKVIIASRKEKALKEVADELNGHSQGSCEYIVADLGTKAGCDFLASEVKKRTDKVHILINNSGVTWGAQFDKVPEKEGWDRVFALNVKSIFYLTSALTPLLAEGSDNLDPGRVINIXSVAGLD 702
            +G  +A  LA  G KV++  R E  L EVA  +  + Q   E  + D+  K     L  + K++  ++ IL+N++G+   +   +  + E W+ +  +N+K   Y  +A+ P +     N   G +INI S++G +
Sbjct:   18 IGASIAETLANQGVKVVLTGRDESRLAEVAKRIQDNKQAVVETSIVDVTHKEEVTELVEKTKEKFGQIDILVNSAGLMLSSAITE-GDVEAWEAMIDVNIKGTLYTINAVLPSML----NQSSGHIINIASISGFE 148          
The following BLAST results are available for this feature:
BLAST of FC920495 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
RHLG_PSEAE5.933e-2039.26Rhamnolipids biosynthesis 3-oxoacyl-[acyl-carrier-... [more]
Y0419_STAS16.575e-1127.21Uncharacterized oxidoreductase SSP0419 OS=Staphylo... [more]
back to top
Properties
Property NameValue
Genbank descriptionC32009B07EF RVDevelop1 Citrus clementina cDNA clone C32009B07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920495 ID=FC920495|Name=FC920495|organism=Citrus clementina|type=EST|length=706bp
TGCTGCTGGTTTGGCTTTTCTCGAGATTCTGGCTGATTGAAGCGTCGTCG
CATCTTCCTGATCACTGCTGTTGGCATCTCGCGAACCTGCTGCGCCCATT
CCTGTCCTCTGGCATCTGCAACTCCTCCAACTTTTGGTCGATATTTCGAC
TACATAGTATCAAGAGCCCGGACCTTCACGGCATAATACTTGGAGCAAGC
ATTCAAGAGAGCTCCCTACAACATGAGCCTTGCGGTACCTCGACTATTCG
ATGTCAAAGGAAAGGTCGCAGTCGTTACAGGAGGAGGCAGCGGCCTCGGA
ACGATGATGGCGACTGCCCTTGCGCAAAACGGCGCGAAAGTCATCATCGC
CTCAAGAAAAGAGAAAGCCCTGAAAGAGGTTGCCGACGAATTGAACGGTC
ACTCGCAGGGTAGTTGCGAATACATTGTAGCAGACCTGGGCACGAAAGCT
GGGTGCGACTTCCTCGCTAGCGAAGTGAAGAAGCGCACAGACAAAGTCCA
CATCCTCATCAACAATTCAGGAGTAACCTGGGGCGCTCAGTTCGATAAGG
TTCCAGAGAAAGAAGGCTGGGATCGCGTTTTTGCGCTAAACGTCAAGAGC
ATCTTCTACCTTACTTCCGCACTAACGCCTTTGCTTGCGGAGGGATCTGA
CAACCTTGACCCTGGTCGCGTCATCAACATCGNCAGCGTAGCAGGCTTGG
ACCCTG
back to top