FC920497

Overview
NameFC920497
Unique NameFC920497
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length702
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig5819 contig Ccv1_Contig5819:118..819. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920497 vs. ExPASy Swiss-Prot
Match: HACL1_RAT (2-hydroxyacyl-CoA lyase 1 OS=Rattus norvegicus GN=Hacl1 PE=1 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 2.607e-36
Identity = 77/215 (35.81%), Postives = 119/215 (55.35%), Query Frame = 3
Query:   66 QIDGNTLAAKSLSLFGATHMFGVVGIPVTSLANLAVQLGVRFIAFHNEQXXXXXXXXXXXLTGKPGILLTVSGPGCVHGLAGLSNGMINTWPIVMISGSCDQKDFGRGDFQELDQVEAVKPFSKFAVKAKDITEVPKCVAQVLERAVSGRPGGCYLDLPTDVL---HQTISVXXXXXXXXXXXXXIETVTQGGIVNSDIDKAVSLLKEAKKPLIV 701
            Q+ G  + A++L      +MFGVVGIPVT +A  A +LG+++I   NEQ           LTG+PG+ L VSGPG +H L G++N  +N WP+++I GS ++     G FQE  QVEA + +SKF+ +   I  +P  + + +  ++ GRPG CY+D+P D++     T S+              ET        S +  A S+L+ AK+PL++
Sbjct:   16 QVSGAKVIAQALKTQDVEYMFGVVGIPVTEIALAAQELGIKYIGMRNEQAACYAASAVGYLTGRPGVCLVVSGPGLIHALGGMANANMNCWPLIVIGGSSERNQEAMGAFQEFPQVEACRLYSKFSARPSSIQHIPFVIEKAVRSSIYGRPGACYIDVPADLVTLQESTTSIKYKECCMPPPLSLAET--------SAVRAAASVLRSAKQPLLI 222          
BLAST of FC920497 vs. ExPASy Swiss-Prot
Match: HACL1_MOUSE (2-hydroxyacyl-CoA lyase 1 OS=Mus musculus GN=Hacl1 PE=1 SV=2)

HSP 1 Score: 148.288 bits (373), Expect = 3.765e-35
Identity = 73/212 (34.43%), Postives = 117/212 (55.19%), Query Frame = 3
Query:   66 QIDGNTLAAKSLSLFGATHMFGVVGIPVTSLANLAVQLGVRFIAFHNEQXXXXXXXXXXXLTGKPGILLTVSGPGCVHGLAGLSNGMINTWPIVMISGSCDQKDFGRGDFQELDQVEAVKPFSKFAVKAKDITEVPKCVAQVLERAVSGRPGGCYLDLPTDVLHQTISVXXXXXXXXXXXXXIETVTQGGIVNSDIDKAVSLLKEAKKPLIV 701
            Q+ G  + A++L      +MFGVVGIPVT +A  A +LG+++I   NEQ           LTG+PG+ L VSGPG +H L G++N  +N WP+++I GS ++     G FQE  QVEA + ++KF+ +   I  +P  + + +  ++ GRPG CY+D+P D +    +V             +          S +  A S+L++AK+PL++
Sbjct:   16 QVSGAKVIAQALKTQDVEYMFGVVGIPVTEIALAAQELGIKYIGMRNEQAACYAASAVGYLTGRPGVCLVVSGPGLIHALGGMANANMNCWPLIVIGGSSERNQEAMGAFQEFPQVEACRLYTKFSARPSTIELIPFIIEKAVRSSIYGRPGACYIDIPADFVTLQANVTSIKYKECCMPPPVSMAE-----TSAVCAAASVLRDAKQPLLI 222          
BLAST of FC920497 vs. ExPASy Swiss-Prot
Match: HACL1_HUMAN (2-hydroxyacyl-CoA lyase 1 OS=Homo sapiens GN=HACL1 PE=1 SV=2)

HSP 1 Score: 145.976 bits (367), Expect = 1.869e-34
Identity = 71/212 (33.49%), Postives = 117/212 (55.19%), Query Frame = 3
Query:   66 QIDGNTLAAKSLSLFGATHMFGVVGIPVTSLANLAVQLGVRFIAFHNEQXXXXXXXXXXXLTGKPGILLTVSGPGCVHGLAGLSNGMINTWPIVMISGSCDQKDFGRGDFQELDQVEAVKPFSKFAVKAKDITEVPKCVAQVLERAVSGRPGGCYLDLPTDVLHQTISVXXXXXXXXXXXXXIETVTQGGIVNSDIDKAVSLLKEAKKPLIV 701
            Q+ G  + A++L      ++FG+VGIPVT +A  A QLG+++I   NEQ           LT +PG+ L VSGPG +H L G++N  +N WP+++I GS ++     G FQE  QVEA + ++KF+ +   I  +P  + + +  ++ GRPG CY+D+P D ++  ++V             I          S +  A S+++ AK+PL++
Sbjct:   13 QVSGAKVIAQALKTQDVEYIFGIVGIPVTEIAIAAQQLGIKYIGMRNEQAACYAASAIGYLTSRPGVCLVVSGPGLIHALGGMANANMNCWPLLVIGGSSERNQETMGAFQEFPQVEACRLYTKFSARPSSIEAIPFVIEKAVRSSIYGRPGACYVDIPADFVNLQVNVNSIKYMERCMSPPISMAE-----TSAVCTAASVIRNAKQPLLI 219          
BLAST of FC920497 vs. ExPASy Swiss-Prot
Match: OXC_ECOLI (Probable oxalyl-CoA decarboxylase OS=Escherichia coli (strain K12) GN=oxc PE=1 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 2.284e-32
Identity = 80/219 (36.53%), Postives = 120/219 (54.79%), Query Frame = 3
Query:   51 NSQNAQIDGNTLAAKSLSLFGATHMFGVVGIPVTSLANLAVQLGVRFIAFHNEQXXXXXXXXXXXLTGKPGILLTVSGPGCVHGLAGLSNGMINTWPIVMISGSCDQK--DFGRGDFQELDQVEAVKPFSKFAVKAKDITEVPKCVAQVLERAVSGRPGGCYLDLPTDVLHQTISVXXXXXXXXXXXXXIETVTQGGIVNSDIDKAVSLLKEAKKPLIV 701
            + Q    DG  +  ++L       ++GVVGIPVT +A  A   G+R+I F +EQ           LT KPGI LTVS PG ++GL  L+N  +N +P++MISGS D+   D  +GD++ELDQ+ A KP++K A +     ++   +A+ +  +VSGRPGG YLDLP +VL  T+                  +         +  A+SLL +A++PLI+
Sbjct:    2 SDQLQMTDGMHIIVEALKQNNIDTIYGVVGIPVTDMARHAQAEGIRYIGFRHEQSAGYAAAASGFLTQKPGICLTVSAPGFLNGLTALANATVNGFPMIMISGSSDRAIVDLQQGDYEELDQMNAAKPYAKAAFRVNQPQDLGIALARAIRVSVSGRPGGVYLDLPANVLAATMEKDEALTTIVKVENPSPALLP---CPKSVTSAISLLAKAERPLII 217          
BLAST of FC920497 vs. ExPASy Swiss-Prot
Match: OXC_ECO57 (Probable oxalyl-CoA decarboxylase OS=Escherichia coli O157:H7 GN=oxc PE=3 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 2.284e-32
Identity = 80/219 (36.53%), Postives = 120/219 (54.79%), Query Frame = 3
Query:   51 NSQNAQIDGNTLAAKSLSLFGATHMFGVVGIPVTSLANLAVQLGVRFIAFHNEQXXXXXXXXXXXLTGKPGILLTVSGPGCVHGLAGLSNGMINTWPIVMISGSCDQK--DFGRGDFQELDQVEAVKPFSKFAVKAKDITEVPKCVAQVLERAVSGRPGGCYLDLPTDVLHQTISVXXXXXXXXXXXXXIETVTQGGIVNSDIDKAVSLLKEAKKPLIV 701
            + Q    DG  +  ++L       ++GVVGIPVT +A  A   G+R+I F +EQ           LT KPGI LTVS PG ++GL  L+N  +N +P++MISGS D+   D  +GD++ELDQ+ A KP++K A +     ++   +A+ +  +VSGRPGG YLDLP +VL  T+                  +         +  A+SLL +A++PLI+
Sbjct:    2 SDQLQMTDGMHIIVEALKQNNIDTIYGVVGIPVTDMARHAQAEGIRYIGFRHEQSAGYAAAASGFLTQKPGICLTVSAPGFLNGLTALANATVNGFPMIMISGSSDRAIVDLQQGDYEELDQMNAAKPYAKAAFRVNQPQDLGIALARAIRVSVSGRPGGVYLDLPANVLAATMEKDEALTTIVKVENPSPALLP---CPKSVTSAISLLAKAERPLII 217          
BLAST of FC920497 vs. ExPASy Swiss-Prot
Match: OXC_OXAFO (Oxalyl-CoA decarboxylase OS=Oxalobacter formigenes GN=oxc PE=1 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 5.626e-31
Identity = 75/220 (34.09%), Postives = 122/220 (55.45%), Query Frame = 3
Query:   51 NSQNAQI-DGNTLAAKSLSLFGATHMFGVVGIPVTSLANLAVQLGVRFIAFHNEQXXXXXXXXXXXLTGKPGILLTVSGPGCVHGLAGLSNGMINTWPIVMISGSCDQK--DFGRGDFQELDQVEAVKPFSKFAVKAKDITEVPKCVAQVLERAVSGRPGGCYLDLPTDVLHQTISVXXXXXXXXXXXXXIETVTQGGIVNSDIDKAVSLLKEAKKPLIV 701
            N  N ++ DG  +   +L +     M+GVVGIP+T+LA +    G RF +F +EQ           + GKPG+ LTVS PG ++G+  L++   N +P++++SGS +++  D  +GD++E+DQ+   +P  K + +   I ++P  +A+ +  AVSGRPGG Y+DLP  +  QTISV             I+           I +A  L+K AK+P+I+
Sbjct:    3 NDDNVELTDGFHVLIDALKMNDIDTMYGVVGIPITNLARMWQDDGQRFYSFRHEQHAGYAASIAGYIEGKPGVCLTVSAPGFLNGVTSLAHATTNCFPMILLSGSSEREIVDLQQGDYEEMDQMNVARPHCKASFRINSIKDIPIGIARAVRTAVSGRPGGVYVDLPAKLFGQTISV---EEANKLLFKPIDPAPAQIPAEDAIARAADLIKNAKRPVIM 219          
BLAST of FC920497 vs. ExPASy Swiss-Prot
Match: HACL1_DICDI (Probable 2-hydroxyacyl-CoA lyase 1 OS=Dictyostelium discoideum GN=hacl1 PE=3 SV=1)

HSP 1 Score: 129.028 bits (323), Expect = 2.364e-29
Identity = 74/213 (34.74%), Postives = 107/213 (50.23%), Query Frame = 3
Query:   69 IDGNTLAAKSLSLFGATHMFGVVGIPVTSLANLAVQLGVRFIAFHNEQXXXXXXXXXXXLTGKPGILLTVSGPGCVHGLAGLSNGMINTWPIVMISGSCDQKDFGRGDFQELDQVEAVKPFSKFAVKAKDITEVPKCVAQVLERAVSGRPGGCYLDLPTDVLHQTISVXXXXXXXXXXXXXIETVTQGGIVNSD--IDKAVSLLKEAKKPLIV 701
            +DG  + AKS+       +FG+VG+P+T +A      GV F  F NEQ           LTG PG+ +TVSGPG VH LAG+ N   N WP++++S S DQ   G+G FQE  Q E+ + + K      +I   P+ +   +E ++S RPG  Y+ +P D+    I                 T+    +V     I  AV LL EAK+PL++
Sbjct:    1 MDGVEIIAKSIKNSAIEKVFGIVGVPITPIAYELQAQGVGFFGFRNEQSCSYAASIVGYLTGLPGLCMTVSGPGVVHALAGVLNAQSNGWPMILLSSSIDQSLVGKGGFQECKQFESAELYCKKCYYLTEIDHFPEILKDAIETSLSNRPGPVYIQIPADL----IKSKCKESPNIREAAGYGTIAIKSVVPDMKLIKDAVQLLSEAKRPLVI 209          
BLAST of FC920497 vs. ExPASy Swiss-Prot
Match: YEC0_YEAST (Putative 2-hydroxyacyl-CoA lyase OS=Saccharomyces cerevisiae GN=YEL020C PE=1 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 1.694e-27
Identity = 61/155 (39.35%), Postives = 86/155 (55.48%), Query Frame = 3
Query:   90 AKSLSLFGATHMFGVVGIPVTSLANLAVQLGVRFIAFHNEQXXXXXXXXXXXLTGKPGILLTVSGPGCVHGLAGLSNGMINTWPIVMISGSCDQKDFGRGDFQELDQVEAVKPFSKFAVKAKDITEVPKCVAQVLERAVSGRPGGCYLDLPTDVL 554
            A+ L  +G   +FG+VGIP+  LA+  V  G++FI   NEQ           ++ KPG+LL V GPG +H LAG+ N M N WP+++I+GS  Q D  +G FQELDQV  + PF KF  K      +     + L   + G  G  Y+D+P D +
Sbjct:   10 AQLLQKYGIDTVFGIVGIPIVQLADTMVANGIKFIPCRNEQAASYAASAYGYISDKPGVLLIVGGPGLIHALAGIYNSMSNRWPLLVIAGSSSQSDIHKGGFQELDQVSLLSPFLKFTGKLTP-DNIDMITQKALNYCIQGTAGVSYIDVPADFI 163          
BLAST of FC920497 vs. ExPASy Swiss-Prot
Match: YGK4_SCHPO (Putative 2-hydroxyacyl-CoA lyase OS=Schizosaccharomyces pombe GN=SPBC725.04 PE=2 SV=1)

HSP 1 Score: 122.094 bits (305), Expect = 2.890e-27
Identity = 69/211 (32.70%), Postives = 104/211 (49.29%), Query Frame = 3
Query:   69 IDGNTLAAKSLSLFGATHMFGVVGIPVTSLANLAVQLGVRFIAFHNEQXXXXXXXXXXXLTGKPGILLTVSGPGCVHGLAGLSNGMINTWPIVMISGSCDQKDFGRGDFQELDQVEAVKPFSKFAVKAKDITEVPKCVAQVLERAVSGRPGGCYLDLPTDVLHQTISVXXXXXXXXXXXXXIETVTQGGIVNSDIDKAVSLLKEAKKPLIV 701
            I  + L AK+L       +FG+VGIPV  +       G+RF+ F NEQ           LT +PG+ + V GPG VH +AG+ N   N WP+++++GS +      G FQELDQV  + P +K AV+      V   + +    +++G PG CY+DLP + +  T+               I +  +     + + KA   LK AK PL+V
Sbjct:    3 ISFSELVAKTLLDLEVKVVFGIVGIPVIEICEAIQASGIRFVGFRNEQSAAYAATAYGYLTQRPGVCVVVGGPGVVHAMAGVFNSKTNRWPLLLLAGSSETFQQNCGAFQELDQVSYLSPHTKLAVRPPSPKMVVDSIRRAYRVSMTGTPGTCYVDLPANYIESTVD-----DFPKDPLPPIPSSPKCAPDPTQLQKAAYYLKNAKAPLLV 208          
BLAST of FC920497 vs. ExPASy Swiss-Prot
Match: ILVI_BUCBP (Acetolactate synthase large subunit OS=Buchnera aphidicola subsp. Baizongia pistaciae GN=ilvI PE=3 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 2.452e-18
Identity = 61/211 (28.91%), Postives = 99/211 (46.92%), Query Frame = 3
Query:   69 IDGNTLAAKSLSLFGATHMFGVVGIPVTSLANLAVQL-GVRFIAFHNEQXXXXXXXXXXXLTGKPGILLTVSGPGCVHGLAGLSNGMINTWPIVMISGSCDQKDFGRGDFQELDQVEAVKPFSKFAVKAKDITEVPKCVAQVLERAVSGRPGGCYLDLPTDVLHQTISVXXXXXXXXXXXXXIETVTQGGIVNSDIDKAVSLLKEAKKPLI 698
            + G+ +  +SL   G  ++FG  G  V  + +   Q+ G++ I   +EQ            TGK G++L  SGPG  + + G++   +++ P+V+ISG       G   FQE D +   +P  K +   K+  ++PK   +    A SGRPG   +DLP D+L+  I                  V QG      I KA+ +L +AK+P+I
Sbjct:    4 LSGSDMVIRSLIDQGIKYIFGYPGGAVLDIYDSLKQMHGIKHILVRHEQSATHMADGYARATGKIGVVLVTSGPGATNSITGIATAYMDSIPLVVISGQVASSLIGYDAFQECDMIGISRPIVKHSFLVKNTEDIPKIFKKAFWLASSGRPGPIVIDLPKDILNPLIK-KPYIWPKLISIRSYSPVLQGH--QGQIKKALHILIKAKQPII 211          
The following BLAST results are available for this feature:
BLAST of FC920497 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 56
Match NameE-valueIdentityDescription
HACL1_RAT2.607e-3635.812-hydroxyacyl-CoA lyase 1 OS=Rattus norvegicus GN=... [more]
HACL1_MOUSE3.765e-3534.432-hydroxyacyl-CoA lyase 1 OS=Mus musculus GN=Hacl1... [more]
HACL1_HUMAN1.869e-3433.492-hydroxyacyl-CoA lyase 1 OS=Homo sapiens GN=HACL1... [more]
OXC_ECOLI2.284e-3236.53Probable oxalyl-CoA decarboxylase OS=Escherichia c... [more]
OXC_ECO572.284e-3236.53Probable oxalyl-CoA decarboxylase OS=Escherichia c... [more]
OXC_OXAFO5.626e-3134.09Oxalyl-CoA decarboxylase OS=Oxalobacter formigenes... [more]
HACL1_DICDI2.364e-2934.74Probable 2-hydroxyacyl-CoA lyase 1 OS=Dictyosteliu... [more]
YEC0_YEAST1.694e-2739.35Putative 2-hydroxyacyl-CoA lyase OS=Saccharomyces ... [more]
YGK4_SCHPO2.890e-2732.70Putative 2-hydroxyacyl-CoA lyase OS=Schizosaccharo... [more]
ILVI_BUCBP2.452e-1828.91Acetolactate synthase large subunit OS=Buchnera ap... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32009B11EF RVDevelop1 Citrus clementina cDNA clone C32009B11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920497 ID=FC920497|Name=FC920497|organism=Citrus clementina|type=EST|length=702bp
GAATATCAAATTTGCTTCCTCCAATGCTTCATCCATCATCTCCATTGCAA
AATTCCCAAAATGCCCAGATCGACGGCAACACCCTGGCGGCCAAATCCTT
GTCACTATTCGGTGCCACCCACATGTTCGGCGTGGTGGGCATTCCCGTTA
CTTCCTTAGCGAACCTGGCCGTCCAGCTCGGCGTCCGGTTCATCGCCTTC
CACAATGAGCAGTCCGCTGGCTACGCCGCCTCAGCCTACGGATACCTGAC
TGGAAAACCCGGCATTCTGTTAACTGTTTCCGGTCCGGGTTGCGTGCACG
GTCTGGCTGGTCTCTCGAATGGGATGATTAACACCTGGCCAATCGTCATG
ATATCCGGCTCCTGCGATCAGAAAGATTTTGGCCGCGGCGATTTTCAAGA
ACTCGACCAAGTGGAAGCCGTCAAGCCTTTTTCGAAATTTGCTGTAAAAG
CGAAGGACATTACGGAAGTTCCCAAGTGTGTCGCTCAGGTTCTTGAACGG
GCTGTTTCGGGGCGGCCCGGCGGGTGTTATTTGGATCTACCCACTGATGT
TTTACATCAAACGATATCGGTATCTGAAGCGGAGAAGCTTCTGAAGGAAG
CGGAGAGTGCCATAGAAACGGTGACGCAAGGGGGGATTGTGAATTCTGAT
ATCGATAAAGCGGTGTCTTTGCTTAAAGAAGCAAAGAAGCCGTTGATTGT
GT
back to top