FC920649

Overview
NameFC920649
Unique NameFC920649
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length724
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14114 contig Ccv1_Contig14114:20..746. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920649 vs. ExPASy Swiss-Prot
Match: ALFC_SPIOL (Fructose-bisphosphate aldolase, chloroplastic OS=Spinacia oleracea PE=1 SV=3)

HSP 1 Score: 282.722 bits (722), Expect = 1.348e-75
Identity = 152/205 (74.15%), Postives = 165/205 (80.49%), Query Frame = 2
Query:  125 PVLDKSEWVKGQAIR-QSTVSVRSLPSGPSSLTIRAGSYADELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYH--------RELVS-PNGVLL*ASPWPICLGSQGSAWGLA 709
            PVLD  E++KGQ +R  S   VR  PSG SSLT+RA SYADELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLL++APGLGQY+SGAILFEETLYQSTTDGKKMVDVL+EQ IVPGIKVDKG +PL GSNDESWCQGLDGLA R+AAYY         R +VS PNG        P  L  + +AWGLA
Sbjct:   11 PVLDNPEFLKGQTLRIPSVAGVRFTPSGSSSLTVRASSYADELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLISAPGLGQYVSGAILFEETLYQSTTDGKKMVDVLIEQGIVPGIKVDKGWLPLPGSNDESWCQGLDGLACRSAAYYQQGARFAKWRTVVSIPNG--------PSALAVKEAAWGLA 207          
BLAST of FC920649 vs. ExPASy Swiss-Prot
Match: ALFC1_ARATH (Probable fructose-bisphosphate aldolase 1, chloroplastic OS=Arabidopsis thaliana GN=FBA1 PE=1 SV=2)

HSP 1 Score: 273.092 bits (697), Expect = 1.068e-72
Identity = 151/204 (74.02%), Postives = 164/204 (80.39%), Query Frame = 2
Query:  137 KSEWVKGQAI---RQSTVSVRSLPSGPSSLTIRAGS-YADELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYH--------RELVS-PNGVLL*ASPWPICLGSQGSAWGLA 709
            KS+WVKGQ++   + S+VS       PS+LT+RA S YADELVKTAKT+ASPG GI+AMDESNATCGKRLASIGLENTEANRQAYRTLLV+APGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPL GS DESWCQGLDGLASRTAAYY         R +VS PNG        P  L  + +AWGLA
Sbjct:   15 KSDWVKGQSLLLRQPSSVSAIRSHVAPSALTVRAASAYADELVKTAKTIASPGHGIMAMDESNATCGKRLASIGLENTEANRQAYRTLLVSAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLVGSYDESWCQGLDGLASRTAAYYQQGARFAKWRTVVSIPNG--------PSALAVKEAAWGLA 210          
BLAST of FC920649 vs. ExPASy Swiss-Prot
Match: ALFC2_ARATH (Probable fructose-bisphosphate aldolase 2, chloroplastic OS=Arabidopsis thaliana GN=FBA2 PE=1 SV=1)

HSP 1 Score: 272.322 bits (695), Expect = 1.822e-72
Identity = 151/207 (72.95%), Postives = 168/207 (81.16%), Query Frame = 2
Query:  125 PVLDKSEWVKGQAI--RQSTVSVRSLPSGPSSLTIRAGS-YADELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYH--------RELVS-PNGVLL*ASPWPICLGSQGSAWGLA 709
            PVLDKSEWVKGQ++  RQ + +   L +  +SLT+RA S YADELVKTAKT+ASPGRGILAMDESNATCGKRL SIGLENTEANRQA+RTLLV+APGLGQY+SGAILFEETLYQSTT+GKKMVDVLVEQNIVPGIKVDKGLVPL GSN+ESW QGLDGL+SRTAAYY         R +VS PNG        P  L  + +AWGLA
Sbjct:   11 PVLDKSEWVKGQSVLFRQPSSASVVLRNRATSLTVRAASSYADELVKTAKTIASPGRGILAMDESNATCGKRLDSIGLENTEANRQAFRTLLVSAPGLGQYVSGAILFEETLYQSTTEGKKMVDVLVEQNIVPGIKVDKGLVPLVGSNNESWGQGLDGLSSRTAAYYQQGARFAKWRTVVSIPNG--------PSALAVKEAAWGLA 209          
BLAST of FC920649 vs. ExPASy Swiss-Prot
Match: ALFC1_PEA (Fructose-bisphosphate aldolase 1, chloroplastic (Fragment) OS=Pisum sativum PE=1 SV=1)

HSP 1 Score: 257.299 bits (656), Expect = 6.065e-68
Identity = 136/174 (78.16%), Postives = 147/174 (84.48%), Query Frame = 2
Query:  215 LTIRAGSYADELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYH--------RELVS-PNGVLL*ASPWPICLGSQGSAWGLA 709
            LTIRAGSYADELVKTAKT+ASPGRGILAMDESNATCGKRLASIGLENTE NRQA+RTLLVT P LG+YISGAILFEETLYQSTTDG+K+VDVL+EQNI+PGIKVDKGLVPLAGSNDESWCQGLDGLASR+AAYY         R +VS PNG        P  L  + +AWGLA
Sbjct:    2 LTIRAGSYADELVKTAKTIASPGRGILAMDESNATCGKRLASIGLENTEVNRQAWRTLLVTVPTLGEYISGAILFEETLYQSTTDGRKIVDVLIEQNIIPGIKVDKGLVPLAGSNDESWCQGLDGLASRSAAYYQQGARFAKWRTVVSIPNG--------PSALAVKEAAWGLA 167          
BLAST of FC920649 vs. ExPASy Swiss-Prot
Match: ALFC_ORYSJ (Fructose-bisphosphate aldolase, chloroplastic OS=Oryza sativa subsp. japonica GN=Os11g0171300 PE=1 SV=2)

HSP 1 Score: 254.988 bits (650), Expect = 3.010e-67
Identity = 143/201 (71.14%), Postives = 154/201 (76.62%), Query Frame = 2
Query:  137 KSEW-VKGQAIRQSTVSVRSLPSGPSSLTIRAGSYADELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYH--------RELVS-PNGVLL*ASPWPICLGSQGSAWGLA 709
            KSEW    QA     V+V        S+ +RAG+Y DELVKTAKT+ASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQST DGKK+VD+L EQ IVPGIKVDKGLVPLAGSN+ESWCQGLDGLASR AAYY         R +VS PNG        P  L  + +AWGLA
Sbjct:   15 KSEWGATRQAAAPKPVTV--------SMVVRAGAYDDELVKTAKTIASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTVDGKKIVDILTEQKIVPGIKVDKGLVPLAGSNNESWCQGLDGLASREAAYYQQGARFAKWRTVVSIPNG--------PSELAVKEAAWGLA 199          
BLAST of FC920649 vs. ExPASy Swiss-Prot
Match: ALFC2_PEA (Fructose-bisphosphate aldolase 2, chloroplastic OS=Pisum sativum PE=1 SV=2)

HSP 1 Score: 244.588 bits (623), Expect = 4.068e-64
Identity = 130/169 (76.92%), Postives = 141/169 (83.43%), Query Frame = 2
Query:  230 GSYADELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYH--------RELVS-PNGVLL*ASPWPICLGSQGSAWGLA 709
            GSYADELVKTAKT+ASPGRGILAMDESNATCGKRL SIGLENTEANRQA+RTLLVT P LG+YISGAILFEETLYQST DG+K+VDVLVEQNI+PGIKVDKGLVPLAGSN+ESWCQGLDGLASR+AAYY         R +VS PNG        P  L  + +AWGLA
Sbjct:    1 GSYADELVKTAKTIASPGRGILAMDESNATCGKRLDSIGLENTEANRQAWRTLLVTVPTLGEYISGAILFEETLYQSTVDGRKIVDVLVEQNIIPGIKVDKGLVPLAGSNNESWCQGLDGLASRSAAYYQQGARFAKWRTVVSIPNG--------PSALAVKEAAWGLA 161          
BLAST of FC920649 vs. ExPASy Swiss-Prot
Match: ALFC3_ARATH (Probable fructose-bisphosphate aldolase 3, chloroplastic OS=Arabidopsis thaliana GN=FBA3 PE=1 SV=1)

HSP 1 Score: 231.106 bits (588), Expect = 4.655e-60
Identity = 123/191 (64.40%), Postives = 144/191 (75.39%), Query Frame = 2
Query:  140 SEWVKGQAIRQSTVSVRSLPSGPSSLTIRAGSYADELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYHRELVSPNGVLL*ASP-WPICLGSQGSAWGLA 709
            S W+  ++   ++ S  S P    S  IRAG+Y+DELVKTAK++ASPGRGILA+DESNATCGKRLASIGL+NTE NRQAYR LL+T PGLG YISG+ILFEETLYQST DGK  VD L + NIVPGIKVDKGL PLAGSN+ESWCQGLDGLASR+A YY +         + + P  P  L  + +AWGLA
Sbjct:   14 SPWIGQRSFAHTSAS--SSPPPRVSFAIRAGAYSDELVKTAKSIASPGRGILAIDESNATCGKRLASIGLDNTEDNRQAYRQLLLTTPGLGDYISGSILFEETLYQSTKDGKTFVDCLRDANIVPGIKVDKGLSPLAGSNEESWCQGLDGLASRSAEYYKQGARFAKWRTVVSVPCGPSALAVKEAAWGLA 202          
BLAST of FC920649 vs. ExPASy Swiss-Prot
Match: ALFC_CHLRE (Fructose-bisphosphate aldolase 1, chloroplastic OS=Chlamydomonas reinhardtii GN=ALDCHL PE=2 SV=1)

HSP 1 Score: 189.889 bits (481), Expect = 4.530e-52
Identity = 100/129 (77.52%), Postives = 106/129 (82.17%), Query Frame = 2
Query:  230 GSYADELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYY 616
            G Y +EL+KTA TVAS GRGILAMDESNATCGKRL SIG+ENTE NR+AYR LLVTAPGLGQYISGAILFEETLYQST  GKK VDV+ EQNIVPGIKVDKGLVP   +   SWC GLDG  S  A YY
Sbjct:   28 GKYDEELIKTAGTVASKGRGILAMDESNATCGKRLDSIGVENTEENRRAYRELLVTAPGLGQYISGAILFEETLYQSTASGKKFVDVMKEQNIVPGIKVDKGLVP-CPTPTMSWCMGLDGWTS-AAEYY 154          

HSP 2 Score: 36.1946 bits (82), Expect = 4.530e-52
Identity = 19/33 (57.58%), Postives = 20/33 (60.61%), Query Frame = 1
Query:  622 GARFAKWRTVVSIPMAHLPWQSRKRLGSCRYAA 720
            GARFAKWR+VVSIP        R   G  RYAA
Sbjct:  157 GARFAKWRSVVSIPHGPSIMLPRLAYGLARYAA 189          
BLAST of FC920649 vs. ExPASy Swiss-Prot
Match: ALF_ARATH (Fructose-bisphosphate aldolase, cytoplasmic isozyme OS=Arabidopsis thaliana GN=At4g26520 PE=2 SV=2)

HSP 1 Score: 166.007 bits (419), Expect = 5.009e-41
Identity = 82/127 (64.57%), Postives = 97/127 (76.38%), Query Frame = 2
Query:  236 YADELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYY 616
            Y DEL+KTAK +A+PGRGILA DES  T GKR A I +ENTE+NRQAYR LL T+PG    +SG ILFEETLYQ T+DGK  VD+L+E  ++PGIKVDKGLV LAG+N E+  QGLD L +R   YY
Sbjct:    8 YEDELIKTAKYIATPGRGILAADESTETIGKRFAGINVENTESNRQAYRELLFTSPGSYPCLSGVILFEETLYQKTSDGKPFVDLLMENGVIPGIKVDKGLVDLAGTNGETTTQGLDSLGARCQQYY 134          

HSP 2 Score: 23.0978 bits (48), Expect = 5.009e-41
Identity = 9/13 (69.23%), Postives = 9/13 (69.23%), Query Frame = 1
Query:  622 GARFAKWRTVVSI 660
            GARFAKWR    I
Sbjct:  137 GARFAKWRAFFKI 149          
BLAST of FC920649 vs. ExPASy Swiss-Prot
Match: ALF1_PEA (Fructose-bisphosphate aldolase, cytoplasmic isozyme 1 OS=Pisum sativum PE=2 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 8.503e-41
Identity = 79/129 (61.24%), Postives = 98/129 (75.97%), Query Frame = 2
Query:  230 GSYADELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYY 616
            G YADEL+K AK +A+PG+GILA DES  T GKRLASI +EN EANRQA R LL T+P   QY+SG ILFEETLYQ +++GK  V++L E N++PGIKVDKG+V LAG++ E+  QG D L +R   YY
Sbjct:    6 GKYADELIKNAKYIATPGKGILAADESTGTIGKRLASINVENIEANRQALRELLFTSPNALQYLSGVILFEETLYQKSSEGKPFVEILQENNVIPGIKVDKGVVELAGTDGETTTQGFDSLGARCQQYY 134          

HSP 2 Score: 25.7942 bits (55), Expect = 8.503e-41
Identity = 10/13 (76.92%), Postives = 11/13 (84.62%), Query Frame = 1
Query:  622 GARFAKWRTVVSI 660
            GARFAKWR V+ I
Sbjct:  137 GARFAKWRAVLKI 149          
The following BLAST results are available for this feature:
BLAST of FC920649 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 56
Match NameE-valueIdentityDescription
ALFC_SPIOL1.348e-7574.15Fructose-bisphosphate aldolase, chloroplastic OS=S... [more]
ALFC1_ARATH1.068e-7274.02Probable fructose-bisphosphate aldolase 1, chlorop... [more]
ALFC2_ARATH1.822e-7272.95Probable fructose-bisphosphate aldolase 2, chlorop... [more]
ALFC1_PEA6.065e-6878.16Fructose-bisphosphate aldolase 1, chloroplastic (F... [more]
ALFC_ORYSJ3.010e-6771.14Fructose-bisphosphate aldolase, chloroplastic OS=O... [more]
ALFC2_PEA4.068e-6476.92Fructose-bisphosphate aldolase 2, chloroplastic OS... [more]
ALFC3_ARATH4.655e-6064.40Probable fructose-bisphosphate aldolase 3, chlorop... [more]
ALFC_CHLRE4.530e-5277.52Fructose-bisphosphate aldolase 1, chloroplastic OS... [more]
ALF_ARATH5.009e-4164.57Fructose-bisphosphate aldolase, cytoplasmic isozym... [more]
ALF1_PEA8.503e-4161.24Fructose-bisphosphate aldolase, cytoplasmic isozym... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32011C05EF RVDevelop1 Citrus clementina cDNA clone C32011C05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920649 ID=FC920649|Name=FC920649|organism=Citrus clementina|type=EST|length=724bp
AAAGATAGTGAAGATAAGATTATAAGTGCTATAAGCTAAGGCCTCTCGAG
CTCAGAACCCACAGCAAGAAGAAGCAAAGAGGAAAATGGCCTCAGCCTCG
GCATCTTTACTCAAGTCATCATCCCCCGTTCTTGACAAGTCTGAGTGGGT
TAAGGGCCAGGCCATCCGCCAGTCTACTGTCTCAGTCCGCAGCCTCCCCA
GTGGCCCCTCTTCCCTCACCATCCGTGCTGGTTCCTATGCCGATGAGCTT
GTCAAGACCGCGAAAACTGTTGCATCACCAGGACGTGGAATTTTGGCCAT
GGATGAGTCAAATGCAACTTGTGGAAAACGCCTTGCCTCAATTGGGTTAG
AGAACACTGAGGCTAACCGCCAGGCATACCGTACCCTCCTTGTTACAGCC
CCTGGTCTTGGACAGTACATCTCTGGTGCCATCCTTTTTGAGGAGACTCT
CTACCAATCCACCACCGATGGCAAGAAGATGGTCGATGTTCTTGTTGAGC
AAAACATTGTCCCCGGTATCAAAGTCGACAAGGGTTTGGTGCCCCTTGCT
GGTTCCAATGATGAGTCATGGTGCCAGGGTCTTGATGGCCTGGCTTCTCG
CACTGCTGCTTACTACCACAGGGAGCTCGTTTCGCCAAATGGCGTACTGT
TGTGAGCATCCCCATGGCCCATCTGCCTTGGCAGTCAAGGAAGCGCCTGG
GGTCTTGCCGCTATGCTGCATGCT
back to top