FC920656

Overview
NameFC920656
Unique NameFC920656
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length676
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig13958 contig Ccv1_Contig13958:5..680. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920656 vs. ExPASy Swiss-Prot
Match: P2C75_ARATH (Probable protein phosphatase 2C 75 OS=Arabidopsis thaliana GN=AHG1 PE=2 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 3.086e-23
Identity = 62/177 (35.03%), Postives = 95/177 (53.67%), Query Frame = 2
Query:  149 MTEVYQRMPSDQNDD-SPAKCXXXXXXXXXXXXFGAIVATSSEPTASDIRKEKRTEDSDRVAEGKRMRTEAETKDTPATETDVNS--SPSSGEGTEKVVSLAATTEVQAVEPIFGTMSVTGRSREMEDAISTRTSLCSPDINWRRPVHFFAVYDGHGGRHVSSLCKEKMHVIMEEEL 670
            MTE+Y+ + + + DD SP KC              A+     EP++S  R   RT+     +    +R +A   +      D+    +P +    +K  +     E    EP++G +SV GRSR+MED+++ + +LC P++N +RPVHFFAVYDGHGG  VS+LC   MH  ++EEL
Sbjct:    1 MTEIYRTISTGRGDDVSPTKCRERRRRRIEMRRQAAVFG---EPSSS--RNRDRTDMEVYSSFDVPLRKQARRSEIGGLPADIGGFLAPPAASSCQKSEAPVWKGEETEDEPLYGIVSVMGRSRKMEDSVTVKPNLCKPEVNRQRPVHFFAVYDGHGGSQVSTLCSTTMHTFVKEEL 172          
BLAST of FC920656 vs. ExPASy Swiss-Prot
Match: P2C37_ORYSJ (Probable protein phosphatase 2C 37 OS=Oryza sativa subsp. japonica GN=Os04g0167900 PE=2 SV=2)

HSP 1 Score: 96.6709 bits (239), Expect = 1.213e-19
Identity = 57/171 (33.33%), Postives = 87/171 (50.88%), Query Frame = 2
Query:  170 MPSDQNDDSPAKCXXXXXXXXXXXXFGAIVATSSEPTASDIRKEKRTEDSDRVAEGKRMRTEAETKDTPATETDVNSSPSSGEGTEKVVSLAATTEVQAVEPI-FGTMSVTGRSREMEDAISTRTSLCSPDINWR--RPVHFFAVYDGHGGRHVSSLCKEKMHVIMEEELM 673
            MP    D  PA                A  A+     +S+   EKR+  +   +      + A + D  +   D   S ++G    ++   +  +   AV P+ FG++S+ GR R+MEDA+S R S C+    W    P+HFFAV+DGHGG HVS+LC+E+MHVI+ EE++
Sbjct:   10 MPGGDGDHPPAAAQECHRLRRRRYVPAAAAASEDGDNSSNGGGEKRSLPASSASPSPSPTSSAASSDCSSDRDDDGCSSTAGAAARRLPLPSGASTAAAVWPVAFGSVSLAGRMRDMEDAVSLRPSFCT----WLDGSPMHFFAVFDGHGGPHVSALCREQMHVIVAEEMV 176          
BLAST of FC920656 vs. ExPASy Swiss-Prot
Match: P2C24_ARATH (Probable protein phosphatase 2C 24 OS=Arabidopsis thaliana GN=At2g29380 PE=2 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 2.451e-12
Identity = 34/71 (47.89%), Postives = 46/71 (64.79%), Query Frame = 2
Query:  458 VQAVEPIFGTMSVTGRSREMEDAISTRTSLCSPDINWRRPVHFFAVYDGHGGRHVSSLCKEKMHVIMEEEL 670
            V    P +G  SV GR REMEDA++   S  SP  N   P H+F VYDGHG  HV++ C+E++H +++EEL
Sbjct:   71 VDVSSPRYGVSSVCGRRREMEDAVAIHPSFSSPK-NSEFPQHYFGVYDGHGCSHVAARCRERLHKLVQEEL 140          
BLAST of FC920656 vs. ExPASy Swiss-Prot
Match: P2C03_ARATH (Protein phosphatase 2C 3 OS=Arabidopsis thaliana GN=AIP1 PE=1 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 5.459e-12
Identity = 44/147 (29.93%), Postives = 71/147 (48.30%), Query Frame = 2
Query:  275 PTASDIRKEKRTE------------DSDRVAEGKRMRTEAETKDTPATETDVN-SSPSSGEGTEKVVSLAATTEVQAVEPIFGTMSVTGRSREMEDAISTRTSLCSPDINWRRPV-HFFAVYDGHGGRHVSSLCKEKMHVIMEEELM 673
            PTAS   +E ++E            D    A     ++  E +     ++DV+ S  +S      V+    T +   + P +G  SV GR R+MEDA++   S       + R   H+F VYDGHG  HV++ CKE++H +++EE +
Sbjct:   40 PTASTTEEEDKSEGIYNKRNKQEEYDFMNCASSSPSQSSPEEESVSLEDSDVSISDGNSSVNDVAVIPSKKTVKETDLRPRYGVASVCGRRRDMEDAVALHPSFVRKQTEFSRTRWHYFGVYDGHGCSHVAARCKERLHELVQEEAL 186          
The following BLAST results are available for this feature:
BLAST of FC920656 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
P2C75_ARATH3.086e-2335.03Probable protein phosphatase 2C 75 OS=Arabidopsis ... [more]
P2C37_ORYSJ1.213e-1933.33Probable protein phosphatase 2C 37 OS=Oryza sativa... [more]
P2C24_ARATH2.451e-1247.89Probable protein phosphatase 2C 24 OS=Arabidopsis ... [more]
P2C03_ARATH5.459e-1229.93Protein phosphatase 2C 3 OS=Arabidopsis thaliana G... [more]
back to top
Properties
Property NameValue
Genbank descriptionC32011D01EF RVDevelop1 Citrus clementina cDNA clone C32011D01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920656 ID=FC920656|Name=FC920656|organism=Citrus clementina|type=EST|length=676bp
GGTTTCTTACGTTTCAAAATTAAAAAGAAAATAAATTTTTATTTTCATTT
CATTTCTCCGCTTTGTTACTGTGCATGATGACGTCTTTTACAATGATCGG
AGGCGGTGTTGACGGTTTGCTTAGTTTAATTTCTAACAAGTTTTACCAAT
GACAGAGGTTTATCAAAGAATGCCTAGTGATCAAAATGACGATTCGCCAG
CGAAATGCAGGGAGCGCAGGCGCCGGAGAATAAAAATGAGGCGGTTCGGC
GCAATTGTAGCCACAAGTTCTGAGCCTACGGCTAGTGATATTAGAAAGGA
GAAGCGGACGGAGGACTCGGATCGTGTGGCGGAGGGCAAGAGAATGCGCA
CGGAGGCTGAAACGAAAGATACGCCAGCGACCGAGACTGACGTGAATTCG
TCTCCTTCTTCGGGCGAGGGCACGGAGAAGGTTGTTTCGCTGGCGGCAAC
GACGGAGGTTCAAGCTGTCGAACCTATCTTCGGAACGATGTCCGTCACCG
GGAGATCACGTGAGATGGAGGATGCAATTTCTACGCGGACGAGTCTTTGC
TCACCGGATATAAATTGGCGAAGACCGGTGCATTTCTTCGCTGTGTACGA
CGGCCATGGTGGACGTCACGTGTCATCATTGTGCAAGGAGAAAATGCACG
TGATCATGGAGGAAGAGCTAATGCGC
back to top