FC920665

Overview
NameFC920665
Unique NameFC920665
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length687
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14114 contig Ccv1_Contig14114:11..697. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920665 vs. ExPASy Swiss-Prot
Match: ALFC_SPIOL (Fructose-bisphosphate aldolase, chloroplastic OS=Spinacia oleracea PE=1 SV=3)

HSP 1 Score: 315.849 bits (808), Expect = 1.307e-85
Identity = 158/185 (85.41%), Postives = 169/185 (91.35%), Query Frame = 2
Query:  134 PVLDKSEWVKGQAIR-QSTVSVRSLPSGPSSLTIRAGSYADELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYEQGARFAKWRTVVSIPNGPS 685
            PVLD  E++KGQ +R  S   VR  PSG SSLT+RA SYADELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLL++APGLGQY+SGAILFEETLYQSTTDGKKMVDVL+EQ IVPGIKVDKG +PL GSNDESWCQGLDGLA R+AAYY+QGARFAKWRTVVSIPNGPS
Sbjct:   11 PVLDNPEFLKGQTLRIPSVAGVRFTPSGSSSLTVRASSYADELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLISAPGLGQYVSGAILFEETLYQSTTDGKKMVDVLIEQGIVPGIKVDKGWLPLPGSNDESWCQGLDGLACRSAAYYQQGARFAKWRTVVSIPNGPS 195          
BLAST of FC920665 vs. ExPASy Swiss-Prot
Match: ALFC1_ARATH (Probable fructose-bisphosphate aldolase 1, chloroplastic OS=Arabidopsis thaliana GN=FBA1 PE=1 SV=2)

HSP 1 Score: 306.22 bits (783), Expect = 1.035e-82
Identity = 157/184 (85.33%), Postives = 168/184 (91.30%), Query Frame = 2
Query:  146 KSEWVKGQAI---RQSTVSVRSLPSGPSSLTIRAGS-YADELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYEQGARFAKWRTVVSIPNGPS 685
            KS+WVKGQ++   + S+VS       PS+LT+RA S YADELVKTAKT+ASPG GI+AMDESNATCGKRLASIGLENTEANRQAYRTLLV+APGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPL GS DESWCQGLDGLASRTAAYY+QGARFAKWRTVVSIPNGPS
Sbjct:   15 KSDWVKGQSLLLRQPSSVSAIRSHVAPSALTVRAASAYADELVKTAKTIASPGHGIMAMDESNATCGKRLASIGLENTEANRQAYRTLLVSAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLVGSYDESWCQGLDGLASRTAAYYQQGARFAKWRTVVSIPNGPS 198          
BLAST of FC920665 vs. ExPASy Swiss-Prot
Match: ALFC2_ARATH (Probable fructose-bisphosphate aldolase 2, chloroplastic OS=Arabidopsis thaliana GN=FBA2 PE=1 SV=1)

HSP 1 Score: 305.449 bits (781), Expect = 1.766e-82
Identity = 157/187 (83.96%), Postives = 172/187 (91.98%), Query Frame = 2
Query:  134 PVLDKSEWVKGQAI--RQSTVSVRSLPSGPSSLTIRAGS-YADELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYEQGARFAKWRTVVSIPNGPS 685
            PVLDKSEWVKGQ++  RQ + +   L +  +SLT+RA S YADELVKTAKT+ASPGRGILAMDESNATCGKRL SIGLENTEANRQA+RTLLV+APGLGQY+SGAILFEETLYQSTT+GKKMVDVLVEQNIVPGIKVDKGLVPL GSN+ESW QGLDGL+SRTAAYY+QGARFAKWRTVVSIPNGPS
Sbjct:   11 PVLDKSEWVKGQSVLFRQPSSASVVLRNRATSLTVRAASSYADELVKTAKTIASPGRGILAMDESNATCGKRLDSIGLENTEANRQAFRTLLVSAPGLGQYVSGAILFEETLYQSTTEGKKMVDVLVEQNIVPGIKVDKGLVPLVGSNNESWGQGLDGLSSRTAAYYQQGARFAKWRTVVSIPNGPS 197          
BLAST of FC920665 vs. ExPASy Swiss-Prot
Match: ALFC1_PEA (Fructose-bisphosphate aldolase 1, chloroplastic (Fragment) OS=Pisum sativum PE=1 SV=1)

HSP 1 Score: 290.426 bits (742), Expect = 5.879e-78
Identity = 142/154 (92.21%), Postives = 151/154 (98.05%), Query Frame = 2
Query:  224 LTIRAGSYADELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYEQGARFAKWRTVVSIPNGPS 685
            LTIRAGSYADELVKTAKT+ASPGRGILAMDESNATCGKRLASIGLENTE NRQA+RTLLVT P LG+YISGAILFEETLYQSTTDG+K+VDVL+EQNI+PGIKVDKGLVPLAGSNDESWCQGLDGLASR+AAYY+QGARFAKWRTVVSIPNGPS
Sbjct:    2 LTIRAGSYADELVKTAKTIASPGRGILAMDESNATCGKRLASIGLENTEVNRQAWRTLLVTVPTLGEYISGAILFEETLYQSTTDGRKIVDVLIEQNIIPGIKVDKGLVPLAGSNDESWCQGLDGLASRSAAYYQQGARFAKWRTVVSIPNGPS 155          
BLAST of FC920665 vs. ExPASy Swiss-Prot
Match: ALFC_ORYSJ (Fructose-bisphosphate aldolase, chloroplastic OS=Oryza sativa subsp. japonica GN=Os11g0171300 PE=1 SV=2)

HSP 1 Score: 289.656 bits (740), Expect = 1.003e-77
Identity = 149/181 (82.32%), Postives = 158/181 (87.29%), Query Frame = 2
Query:  146 KSEW-VKGQAIRQSTVSVRSLPSGPSSLTIRAGSYADELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYEQGARFAKWRTVVSIPNGPS 685
            KSEW    QA     V+V        S+ +RAG+Y DELVKTAKT+ASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQST DGKK+VD+L EQ IVPGIKVDKGLVPLAGSN+ESWCQGLDGLASR AAYY+QGARFAKWRTVVSIPNGPS
Sbjct:   15 KSEWGATRQAAAPKPVTV--------SMVVRAGAYDDELVKTAKTIASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTVDGKKIVDILTEQKIVPGIKVDKGLVPLAGSNNESWCQGLDGLASREAAYYQQGARFAKWRTVVSIPNGPS 187          
BLAST of FC920665 vs. ExPASy Swiss-Prot
Match: ALFC2_PEA (Fructose-bisphosphate aldolase 2, chloroplastic OS=Pisum sativum PE=1 SV=2)

HSP 1 Score: 277.715 bits (709), Expect = 3.943e-74
Identity = 136/149 (91.28%), Postives = 145/149 (97.32%), Query Frame = 2
Query:  239 GSYADELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYEQGARFAKWRTVVSIPNGPS 685
            GSYADELVKTAKT+ASPGRGILAMDESNATCGKRL SIGLENTEANRQA+RTLLVT P LG+YISGAILFEETLYQST DG+K+VDVLVEQNI+PGIKVDKGLVPLAGSN+ESWCQGLDGLASR+AAYY+QGARFAKWRTVVSIPNGPS
Sbjct:    1 GSYADELVKTAKTIASPGRGILAMDESNATCGKRLDSIGLENTEANRQAWRTLLVTVPTLGEYISGAILFEETLYQSTVDGRKIVDVLVEQNIIPGIKVDKGLVPLAGSNNESWCQGLDGLASRSAAYYQQGARFAKWRTVVSIPNGPS 149          
BLAST of FC920665 vs. ExPASy Swiss-Prot
Match: ALFC3_ARATH (Probable fructose-bisphosphate aldolase 3, chloroplastic OS=Arabidopsis thaliana GN=FBA3 PE=1 SV=1)

HSP 1 Score: 263.077 bits (671), Expect = 1.005e-69
Identity = 132/179 (73.74%), Postives = 150/179 (83.80%), Query Frame = 2
Query:  149 SEWVKGQAIRQSTVSVRSLPSGPSSLTIRAGSYADELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYEQGARFAKWRTVVSIPNGPS 685
            S W+  ++   ++ S  S P    S  IRAG+Y+DELVKTAK++ASPGRGILA+DESNATCGKRLASIGL+NTE NRQAYR LL+T PGLG YISG+ILFEETLYQST DGK  VD L + NIVPGIKVDKGL PLAGSN+ESWCQGLDGLASR+A YY+QGARFAKWRTVVS+P GPS
Sbjct:   14 SPWIGQRSFAHTSAS--SSPPPRVSFAIRAGAYSDELVKTAKSIASPGRGILAIDESNATCGKRLASIGLDNTEDNRQAYRQLLLTTPGLGDYISGSILFEETLYQSTKDGKTFVDCLRDANIVPGIKVDKGLSPLAGSNEESWCQGLDGLASRSAEYYKQGARFAKWRTVVSVPCGPS 190          
BLAST of FC920665 vs. ExPASy Swiss-Prot
Match: ALFC_CHLRE (Fructose-bisphosphate aldolase 1, chloroplastic OS=Chlamydomonas reinhardtii GN=ALDCHL PE=2 SV=1)

HSP 1 Score: 223.787 bits (569), Expect = 6.758e-58
Identity = 116/149 (77.85%), Postives = 125/149 (83.89%), Query Frame = 2
Query:  239 GSYADELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYEQGARFAKWRTVVSIPNGPS 685
            G Y +EL+KTA TVAS GRGILAMDESNATCGKRL SIG+ENTE NR+AYR LLVTAPGLGQYISGAILFEETLYQST  GKK VDV+ EQNIVPGIKVDKGLVP   +   SWC GLDG  S  A YY+ GARFAKWR+VVSIP+GPS
Sbjct:   28 GKYDEELIKTAGTVASKGRGILAMDESNATCGKRLDSIGVENTEENRRAYRELLVTAPGLGQYISGAILFEETLYQSTASGKKFVDVMKEQNIVPGIKVDKGLVP-CPTPTMSWCMGLDGWTS-AAEYYKAGARFAKWRSVVSIPHGPS 174          
BLAST of FC920665 vs. ExPASy Swiss-Prot
Match: ALF1_PEA (Fructose-bisphosphate aldolase, cytoplasmic isozyme 1 OS=Pisum sativum PE=2 SV=1)

HSP 1 Score: 187.578 bits (475), Expect = 5.367e-47
Identity = 93/150 (62.00%), Postives = 114/150 (76.00%), Query Frame = 2
Query:  239 GSYADELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYEQGARFAKWRTVVSI-PNGPS 685
            G YADEL+K AK +A+PG+GILA DES  T GKRLASI +EN EANRQA R LL T+P   QY+SG ILFEETLYQ +++GK  V++L E N++PGIKVDKG+V LAG++ E+  QG D L +R   YY+ GARFAKWR V+ I PN PS
Sbjct:    6 GKYADELIKNAKYIATPGKGILAADESTGTIGKRLASINVENIEANRQALRELLFTSPNALQYLSGVILFEETLYQKSSEGKPFVEILQENNVIPGIKVDKGVVELAGTDGETTTQGFDSLGARCQQYYKAGARFAKWRAVLKIGPNEPS 155          
BLAST of FC920665 vs. ExPASy Swiss-Prot
Match: ALF_ARATH (Fructose-bisphosphate aldolase, cytoplasmic isozyme OS=Arabidopsis thaliana GN=At4g26520 PE=2 SV=2)

HSP 1 Score: 186.037 bits (471), Expect = 1.562e-46
Identity = 92/142 (64.79%), Postives = 107/142 (75.35%), Query Frame = 2
Query:  245 YADELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYEQGARFAKWRTVVSI 670
            Y DEL+KTAK +A+PGRGILA DES  T GKR A I +ENTE+NRQAYR LL T+PG    +SG ILFEETLYQ T+DGK  VD+L+E  ++PGIKVDKGLV LAG+N E+  QGLD L +R   YYE GARFAKWR    I
Sbjct:    8 YEDELIKTAKYIATPGRGILAADESTETIGKRFAGINVENTESNRQAYRELLFTSPGSYPCLSGVILFEETLYQKTSDGKPFVDLLMENGVIPGIKVDKGLVDLAGTNGETTTQGLDSLGARCQQYYEAGARFAKWRAFFKI 149          
The following BLAST results are available for this feature:
BLAST of FC920665 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 56
Match NameE-valueIdentityDescription
ALFC_SPIOL1.307e-8585.41Fructose-bisphosphate aldolase, chloroplastic OS=S... [more]
ALFC1_ARATH1.035e-8285.33Probable fructose-bisphosphate aldolase 1, chlorop... [more]
ALFC2_ARATH1.766e-8283.96Probable fructose-bisphosphate aldolase 2, chlorop... [more]
ALFC1_PEA5.879e-7892.21Fructose-bisphosphate aldolase 1, chloroplastic (F... [more]
ALFC_ORYSJ1.003e-7782.32Fructose-bisphosphate aldolase, chloroplastic OS=O... [more]
ALFC2_PEA3.943e-7491.28Fructose-bisphosphate aldolase 2, chloroplastic OS... [more]
ALFC3_ARATH1.005e-6973.74Probable fructose-bisphosphate aldolase 3, chlorop... [more]
ALFC_CHLRE6.758e-5877.85Fructose-bisphosphate aldolase 1, chloroplastic OS... [more]
ALF1_PEA5.367e-4762.00Fructose-bisphosphate aldolase, cytoplasmic isozym... [more]
ALF_ARATH1.562e-4664.79Fructose-bisphosphate aldolase, cytoplasmic isozym... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32011D12EF RVDevelop1 Citrus clementina cDNA clone C32011D12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920665 ID=FC920665|Name=FC920665|organism=Citrus clementina|type=EST|length=687bp
AGGCAGAAGAAAGACAGTGAAGATAAGATTATAAGTGCTATAAGCTAAGG
CCTCTCGAGCTCAGAACCCACAGCAAGAAGAAGCAAAGAGGAAAATGGCC
TCAGCCTCGGCATCTTTACTCAAGTCATCATCCCCCGTTCTTGACAAGTC
TGAGTGGGTTAAGGGCCAGGCCATCCGCCAGTCTACTGTCTCAGTCCGCA
GCCTCCCCAGTGGCCCCTCTTCCCTCACCATCCGTGCTGGTTCCTATGCC
GATGAGCTTGTCAAGACCGCGAAAACTGTTGCATCACCAGGACGTGGAAT
TTTGGCCATGGATGAGTCAAATGCAACTTGTGGAAAACGCCTTGCCTCAA
TTGGGTTAGAGAACACTGAGGCTAACCGCCAGGCATACCGTACCCTCCTT
GTTACAGCCCCTGGTCTTGGACAGTACATCTCTGGTGCCATCCTTTTTGA
GGAGACTCTCTACCAATCCACCACCGATGGCAAGAAGATGGTCGATGTTC
TTGTTGAGCAAAACATTGTCCCCGGTATCAAAGTCGACAAGGGTTTGGTG
CCCCTTGCTGGTTCCAATGATGAGTCATGGTGCCAGGGTCTTGATGGCCT
GGCTTCTCGCACTGCTGCCTACTACGAACAGGGAGCTCGTTTCGCCAAAT
GGCGTACTGTTGTGAGCATTCCCAATGGCCCATCTGC
back to top