FC920667

Overview
NameFC920667
Unique NameFC920667
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length701
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14176 contig Ccv1_Contig14176:1..701. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920667 vs. ExPASy Swiss-Prot
Match: HOX32_ORYSJ (Homeobox-leucine zipper protein HOX32 OS=Oryza sativa subsp. japonica GN=HOX32 PE=2 SV=1)

HSP 1 Score: 400.208 bits (1027), Expect = 5.497e-111
Identity = 197/233 (84.55%), Postives = 208/233 (89.27%), Query Frame = 2
Query:    2 RVYSECPQPSSLRRQQLIRECPILSNIEPKQIKVWFQNRRCREKQRKEASRLQTVNRKLSAMNKLLMEENDRLQKQVSHLVYENGYMRQQLHSAPATTTDNSCESVVMSGXXXXXXXXXXXXXXRDASNPAGLLAVAEETLAEFLSKATGTAVDWVQMIGMKPGPDSIGIVAVSRNCSGVAARACGLVSLDPTKIAEILKDCPSWFRDCRCLDVLSVIPTGNGGTIELIYMQT 700
            RVY ECP+PSSLRRQQLIRECPILSNIEPKQIKVWFQNRRCREKQRKEASRLQTVNRKL+AMNKLLMEENDRLQKQVS LVYENGYMRQQLH+    TTD SCESVV SG              RDA+NPAGLLA+AEETLAEFLSKATGTAVDWVQM+GMKPGPDSIGI+AVS NCSGVAARACGLVSL+PTK+AEILKD PSW+RDCRC+DVL VIPTGNGGTIELIYMQT
Sbjct:   46 RVYGECPKPSSLRRQQLIRECPILSNIEPKQIKVWFQNRRCREKQRKEASRLQTVNRKLTAMNKLLMEENDRLQKQVSRLVYENGYMRQQLHNPSVATTDTSCESVVTSGQHHQQQNPAATRPQRDANNPAGLLAIAEETLAEFLSKATGTAVDWVQMVGMKPGPDSIGIIAVSHNCSGVAARACGLVSLEPTKVAEILKDRPSWYRDCRCVDVLHVIPTGNGGTIELIYMQT 278          
BLAST of FC920667 vs. ExPASy Swiss-Prot
Match: HOX32_ORYSI (Homeobox-leucine zipper protein HOX32 OS=Oryza sativa subsp. indica GN=HOX32 PE=2 SV=1)

HSP 1 Score: 400.208 bits (1027), Expect = 5.497e-111
Identity = 197/233 (84.55%), Postives = 208/233 (89.27%), Query Frame = 2
Query:    2 RVYSECPQPSSLRRQQLIRECPILSNIEPKQIKVWFQNRRCREKQRKEASRLQTVNRKLSAMNKLLMEENDRLQKQVSHLVYENGYMRQQLHSAPATTTDNSCESVVMSGXXXXXXXXXXXXXXRDASNPAGLLAVAEETLAEFLSKATGTAVDWVQMIGMKPGPDSIGIVAVSRNCSGVAARACGLVSLDPTKIAEILKDCPSWFRDCRCLDVLSVIPTGNGGTIELIYMQT 700
            RVY ECP+PSSLRRQQLIRECPILSNIEPKQIKVWFQNRRCREKQRKEASRLQTVNRKL+AMNKLLMEENDRLQKQVS LVYENGYMRQQLH+    TTD SCESVV SG              RDA+NPAGLLA+AEETLAEFLSKATGTAVDWVQM+GMKPGPDSIGI+AVS NCSGVAARACGLVSL+PTK+AEILKD PSW+RDCRC+DVL VIPTGNGGTIELIYMQT
Sbjct:   46 RVYGECPKPSSLRRQQLIRECPILSNIEPKQIKVWFQNRRCREKQRKEASRLQTVNRKLTAMNKLLMEENDRLQKQVSRLVYENGYMRQQLHNPSVATTDTSCESVVTSGQHHQQQNPAATRPQRDANNPAGLLAIAEETLAEFLSKATGTAVDWVQMVGMKPGPDSIGIIAVSHNCSGVAARACGLVSLEPTKVAEILKDRPSWYRDCRCVDVLHVIPTGNGGTIELIYMQT 278          
BLAST of FC920667 vs. ExPASy Swiss-Prot
Match: HOX33_ORYSJ (Homeobox-leucine zipper protein HOX33 OS=Oryza sativa subsp. japonica GN=HOX33 PE=2 SV=1)

HSP 1 Score: 396.356 bits (1017), Expect = 7.938e-110
Identity = 193/233 (82.83%), Postives = 209/233 (89.70%), Query Frame = 2
Query:    2 RVYSECPQPSSLRRQQLIRECPILSNIEPKQIKVWFQNRRCREKQRKEASRLQTVNRKLSAMNKLLMEENDRLQKQVSHLVYENGYMRQQLHSAPATTTDNSCESVVMSGXXXXXXXXXXXXXXRDASNPAGLLAVAEETLAEFLSKATGTAVDWVQMIGMKPGPDSIGIVAVSRNCSGVAARACGLVSLDPTKIAEILKDCPSWFRDCRCLDVLSVIPTGNGGTIELIYMQT 700
            RVY+ECP+PSSLRRQQLIRECPILSNIEPKQIKVWFQNRRCREKQRKEASRLQTVNRKL+AMNKLLMEENDRLQKQVS LVYENGYMR QLH+  A TTD SCESVV SG              RDA+NPAGLLA+AEETLAEF+SKATGTAV+WVQM+GMKPGPDSIGI+AVS NCSGVAARACGLVSL+PTK+AEILKD PSW+RDCRC+D++ VIPTGNGGTIELIYMQT
Sbjct:   43 RVYTECPKPSSLRRQQLIRECPILSNIEPKQIKVWFQNRRCREKQRKEASRLQTVNRKLNAMNKLLMEENDRLQKQVSRLVYENGYMRTQLHNPSAATTDTSCESVVTSGQHHQQQNPAVLHPQRDANNPAGLLAIAEETLAEFMSKATGTAVEWVQMVGMKPGPDSIGIIAVSHNCSGVAARACGLVSLEPTKVAEILKDRPSWYRDCRCVDIIHVIPTGNGGTIELIYMQT 275          
BLAST of FC920667 vs. ExPASy Swiss-Prot
Match: HOX33_ORYSI (Homeobox-leucine zipper protein HOX33 OS=Oryza sativa subsp. indica GN=HOX33 PE=2 SV=2)

HSP 1 Score: 396.356 bits (1017), Expect = 7.938e-110
Identity = 193/233 (82.83%), Postives = 209/233 (89.70%), Query Frame = 2
Query:    2 RVYSECPQPSSLRRQQLIRECPILSNIEPKQIKVWFQNRRCREKQRKEASRLQTVNRKLSAMNKLLMEENDRLQKQVSHLVYENGYMRQQLHSAPATTTDNSCESVVMSGXXXXXXXXXXXXXXRDASNPAGLLAVAEETLAEFLSKATGTAVDWVQMIGMKPGPDSIGIVAVSRNCSGVAARACGLVSLDPTKIAEILKDCPSWFRDCRCLDVLSVIPTGNGGTIELIYMQT 700
            RVY+ECP+PSSLRRQQLIRECPILSNIEPKQIKVWFQNRRCREKQRKEASRLQTVNRKL+AMNKLLMEENDRLQKQVS LVYENGYMR QLH+  A TTD SCESVV SG              RDA+NPAGLLA+AEETLAEF+SKATGTAV+WVQM+GMKPGPDSIGI+AVS NCSGVAARACGLVSL+PTK+AEILKD PSW+RDCRC+D++ VIPTGNGGTIELIYMQT
Sbjct:   43 RVYTECPKPSSLRRQQLIRECPILSNIEPKQIKVWFQNRRCREKQRKEASRLQTVNRKLNAMNKLLMEENDRLQKQVSRLVYENGYMRTQLHNPSAATTDTSCESVVTSGQHHQQQNPAVLHPQRDANNPAGLLAIAEETLAEFMSKATGTAVEWVQMVGMKPGPDSIGIIAVSHNCSGVAARACGLVSLEPTKVAEILKDRPSWYRDCRCVDIIHVIPTGNGGTIELIYMQT 275          
BLAST of FC920667 vs. ExPASy Swiss-Prot
Match: ATB14_ARATH (Homeobox-leucine zipper protein ATHB-14 OS=Arabidopsis thaliana GN=ATHB-14 PE=1 SV=1)

HSP 1 Score: 387.497 bits (994), Expect = 3.687e-107
Identity = 190/232 (81.90%), Postives = 207/232 (89.22%), Query Frame = 2
Query:    2 RVYSECPQPSSLRRQQLIRECPILSNIEPKQIKVWFQNRRCREKQRKEASRLQTVNRKLSAMNKLLMEENDRLQKQVSHLVYENGYMRQQLHSAPATTTDNSCESVVMSGXXXXXXXXXXXXXXRDASNPAGLLAVAEETLAEFLSKATGTAVDWVQMIGMKPGPDSIGIVAVSRNCSGVAARACGLVSLDPTKIAEILKDCPSWFRDCRCLDVLSVIPTGNGGTIELIYMQ 697
            RVY+ECP+PSSLRRQQLIRECPILSNIEPKQIKVWFQNRRCREKQRKEA+RLQTVNRKL+AMNKLLMEENDRLQKQVS+LVYENG+M+ QLH+A  TTTDNSCESVV+SG              RDA+NPAGLL++AEE LAEFLSKATGTAVDWVQMIGMKPGPDSIGIVA+SRNCSG+AARACGLVSL+P K+AEILKD PSW RDCR +D LSVIP GNGGTIELIY Q
Sbjct:   39 RVYTECPKPSSLRRQQLIRECPILSNIEPKQIKVWFQNRRCREKQRKEAARLQTVNRKLNAMNKLLMEENDRLQKQVSNLVYENGHMKHQLHTASGTTTDNSCESVVVSGQQHQQQNPNPQHQQRDANNPAGLLSIAEEALAEFLSKATGTAVDWVQMIGMKPGPDSIGIVAISRNCSGIAARACGLVSLEPMKVAEILKDRPSWLRDCRSVDTLSVIPAGNGGTIELIYTQ 270          
BLAST of FC920667 vs. ExPASy Swiss-Prot
Match: ATBH9_ARATH (Homeobox-leucine zipper protein ATHB-9 OS=Arabidopsis thaliana GN=ATHB-9 PE=1 SV=1)

HSP 1 Score: 380.563 bits (976), Expect = 4.507e-105
Identity = 184/232 (79.31%), Postives = 206/232 (88.79%), Query Frame = 2
Query:    2 RVYSECPQPSSLRRQQLIRECPILSNIEPKQIKVWFQNRRCREKQRKEASRLQTVNRKLSAMNKLLMEENDRLQKQVSHLVYENGYMRQQLHSAPATTTDNSCESVVMSGXXXXXXXXXXXXXXRDASNPAGLLAVAEETLAEFLSKATGTAVDWVQMIGMKPGPDSIGIVAVSRNCSGVAARACGLVSLDPTKIAEILKDCPSWFRDCRCLDVLSVIPTGNGGTIELIYMQ 697
            RVY+ECP+PSSLRRQQLIRECPIL NIEP+QIKVWFQNRRCREKQRKE++RLQTVNRKLSAMNKLLMEENDRLQKQVS+LVYENG+M+ ++H+A  TTTDNSCESVV+SG              RD +NPA LL++AEETLAEFL KATGTAVDWVQMIGMKPGPDSIGIVAVSRNCSG+AARACGLVSL+P K+AEILKD PSWFRDCRC++ L+VIPTGNGGTIEL+  Q
Sbjct:   35 RVYAECPKPSSLRRQQLIRECPILCNIEPRQIKVWFQNRRCREKQRKESARLQTVNRKLSAMNKLLMEENDRLQKQVSNLVYENGFMKHRIHTASGTTTDNSCESVVVSGQQRQQQNPTHQHPQRDVNNPANLLSIAEETLAEFLCKATGTAVDWVQMIGMKPGPDSIGIVAVSRNCSGIAARACGLVSLEPMKVAEILKDRPSWFRDCRCVETLNVIPTGNGGTIELVNTQ 266          
BLAST of FC920667 vs. ExPASy Swiss-Prot
Match: REV_ARATH (Homeobox-leucine zipper protein REVOLUTA OS=Arabidopsis thaliana GN=REV PE=1 SV=2)

HSP 1 Score: 347.436 bits (890), Expect = 4.229e-95
Identity = 176/233 (75.54%), Postives = 197/233 (84.55%), Query Frame = 2
Query:    2 RVYSECPQPSSLRRQQLIRECPILSNIEPKQIKVWFQNRRCREKQRKEASRLQTVNRKLSAMNKLLMEENDRLQKQVSHLVYENGYMRQQLHSAPATTTDNSCESVVMSGXXXXXXXXXXXXXXRDASNPAGLLAVAEETLAEFLSKATGTAVDWVQMIGMKPGPDSIGIVAVSRNCSGVAARACGLVSLDPTKIAEILKDCPSWFRDCRCLDVLSVIPTGNGGTIELIYMQT 700
            RVY+ECP+PSSLRRQQLIREC IL+NIEPKQIKVWFQNRRCR+KQRKEASRLQ+VNRKLSAMNKLLMEENDRLQKQVS LV ENGYM+QQL +      D SCESVV +               RDA++PAGLL++AEETLAEFLSKATGTAVDWVQM GMKPGPDS+GI A+S+ C+GVAARACGLVSL+P KIAEILKD PSWFRDCR L+V ++ P GNGGTIEL+YMQT
Sbjct:   39 RVYAECPKPSSLRRQQLIRECSILANIEPKQIKVWFQNRRCRDKQRKEASRLQSVNRKLSAMNKLLMEENDRLQKQVSQLVCENGYMKQQLTTV---VNDPSCESVVTT----------PQHSLRDANSPAGLLSIAEETLAEFLSKATGTAVDWVQMPGMKPGPDSVGIFAISQRCNGVAARACGLVSLEPMKIAEILKDRPSWFRDCRSLEVFTMFPAGNGGTIELVYMQT 258          
BLAST of FC920667 vs. ExPASy Swiss-Prot
Match: ATHB8_ARATH (Homeobox-leucine zipper protein ATHB-8 OS=Arabidopsis thaliana GN=ATHB-8 PE=1 SV=1)

HSP 1 Score: 343.199 bits (879), Expect = 7.975e-94
Identity = 172/233 (73.82%), Postives = 194/233 (83.26%), Query Frame = 2
Query:    2 RVYSECPQPSSLRRQQLIRECPILSNIEPKQIKVWFQNRRCREKQRKEASRLQTVNRKLSAMNKLLMEENDRLQKQVSHLVYENGYMRQQ-LHSAPATTTDNSCESVVMSGXXXXXXXXXXXXXXRDASNPAGLLAVAEETLAEFLSKATGTAVDWVQMIGMKPGPDSIGIVAVSRNCSGVAARACGLVSLDPTKIAEILKDCPSWFRDCRCLDVLSVIPTGNGGTIELIYMQ 697
            R+Y++CP+PSS+RRQQLIRECPILSNIEPKQIKVWFQNRRCREKQRKEASRLQ VNRKL+AMNKLLMEENDRLQKQVSHLVYEN Y RQ   +     TTD SCESVV SG              RDAS PAGLL++A+ETL EF+SKATGTAV+WVQM GMKPGPDSIGIVA+S  C+G+AARACGLV LDPT++AEILKD P W RDCR LD+++V+ T NGGT+ELIYMQ
Sbjct:   29 RLYNDCPKPSSMRRQQLIRECPILSNIEPKQIKVWFQNRRCREKQRKEASRLQAVNRKLTAMNKLLMEENDRLQKQVSHLVYENSYFRQHPQNQGNLATTDTSCESVVTSGQHHLTPQHQP----RDAS-PAGLLSIADETLTEFISKATGTAVEWVQMPGMKPGPDSIGIVAISHGCTGIAARACGLVGLDPTRVAEILKDKPCWLRDCRSLDIVNVLSTANGGTLELIYMQ 256          
BLAST of FC920667 vs. ExPASy Swiss-Prot
Match: ATB15_ARATH (Homeobox-leucine zipper protein ATHB-15 OS=Arabidopsis thaliana GN=ATHB-15 PE=1 SV=1)

HSP 1 Score: 341.658 bits (875), Expect = 2.320e-93
Identity = 169/232 (72.84%), Postives = 194/232 (83.62%), Query Frame = 2
Query:    2 RVYSECPQPSSLRRQQLIRECPILSNIEPKQIKVWFQNRRCREKQRKEASRLQTVNRKLSAMNKLLMEENDRLQKQVSHLVYENGYMRQQLHSAPATTTDNSCESVVMSGXXXXXXXXXXXXXXRDASNPAGLLAVAEETLAEFLSKATGTAVDWVQMIGMKPGPDSIGIVAVSRNCSGVAARACGLVSLDPTKIAEILKDCPSWFRDCRCLDVLSVIPTGNGGTIELIYMQ 697
            R+Y +CP+PSS+RRQQLIRECPILSNIEPKQIKVWFQNRRCREKQRKEASRLQ VNRKL+AMNKLLMEENDRLQKQVS LV+EN Y RQ   +      D SCESVV SG              RDAS PAGLL++AEETLAEFLSKATGTAV+WVQM GMKPGPDSIGI+A+S  C+GVAARACGLV L+PT++AEI+KD PSWFR+CR ++V++V+PT NGGT+EL+YMQ
Sbjct:   31 RLYHDCPKPSSIRRQQLIRECPILSNIEPKQIKVWFQNRRCREKQRKEASRLQAVNRKLTAMNKLLMEENDRLQKQVSQLVHENSYFRQHTPNPSLPAKDTSCESVVTSG----QHQLASQNPQRDAS-PAGLLSIAEETLAEFLSKATGTAVEWVQMPGMKPGPDSIGIIAISHGCTGVAARACGLVGLEPTRVAEIVKDRPSWFRECRAVEVMNVLPTANGGTVELLYMQ 257          
BLAST of FC920667 vs. ExPASy Swiss-Prot
Match: HOX9_ORYSJ (Homeobox-leucine zipper protein HOX9 OS=Oryza sativa subsp. japonica GN=HOX9 PE=2 SV=1)

HSP 1 Score: 339.347 bits (869), Expect = 1.152e-92
Identity = 170/232 (73.28%), Postives = 191/232 (82.33%), Query Frame = 2
Query:    2 RVYSECPQPSSLRRQQLIRECPILSNIEPKQIKVWFQNRRCREKQRKEASRLQTVNRKLSAMNKLLMEENDRLQKQVSHLVYENGYMRQQLHSAPATTTDNSCESVVMSGXXXXXXXXXXXXXXRDASNPAGLLAVAEETLAEFLSKATGTAVDWVQMIGMKPGPDSIGIVAVSRNCSGVAARACGLVSLDPTKIAEILKDCPSWFRDCRCLDVLSVIPTGNGGTIELIYMQ 697
            RVY+ECP+PSS RRQQL+R+CPIL+NIEPKQIKVWFQNRRCR+KQRKEASRLQ VNRKL+AMNKLLMEEN+RLQKQVS LV+EN YM+QQL + P+   D SCES V +               RDASNP+GLL +AEETL EFLSKATGTAVDWV M GMKPGPDS GIVAVS  C GVAARACGLV+L+PTKI EILKD PSWFRDCR L+V ++ P GNGGTIEL+YMQ
Sbjct:   43 RVYAECPKPSSSRRQQLLRDCPILANIEPKQIKVWFQNRRCRDKQRKEASRLQAVNRKLTAMNKLLMEENERLQKQVSQLVHENAYMKQQLQN-PSLGNDTSCESNVTT----------PQNPLRDASNPSGLLTIAEETLTEFLSKATGTAVDWVPMPGMKPGPDSFGIVAVSHGCRGVAARACGLVNLEPTKIVEILKDRPSWFRDCRSLEVFTMFPAGNGGTIELVYMQ 263          
The following BLAST results are available for this feature:
BLAST of FC920667 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 15
Match NameE-valueIdentityDescription
HOX32_ORYSJ5.497e-11184.55Homeobox-leucine zipper protein HOX32 OS=Oryza sat... [more]
HOX32_ORYSI5.497e-11184.55Homeobox-leucine zipper protein HOX32 OS=Oryza sat... [more]
HOX33_ORYSJ7.938e-11082.83Homeobox-leucine zipper protein HOX33 OS=Oryza sat... [more]
HOX33_ORYSI7.938e-11082.83Homeobox-leucine zipper protein HOX33 OS=Oryza sat... [more]
ATB14_ARATH3.687e-10781.90Homeobox-leucine zipper protein ATHB-14 OS=Arabido... [more]
ATBH9_ARATH4.507e-10579.31Homeobox-leucine zipper protein ATHB-9 OS=Arabidop... [more]
REV_ARATH4.229e-9575.54Homeobox-leucine zipper protein REVOLUTA OS=Arabid... [more]
ATHB8_ARATH7.975e-9473.82Homeobox-leucine zipper protein ATHB-8 OS=Arabidop... [more]
ATB15_ARATH2.320e-9372.84Homeobox-leucine zipper protein ATHB-15 OS=Arabido... [more]
HOX9_ORYSJ1.152e-9273.28Homeobox-leucine zipper protein HOX9 OS=Oryza sati... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32011E02EF RVDevelop1 Citrus clementina cDNA clone C32011E02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920667 ID=FC920667|Name=FC920667|organism=Citrus clementina|type=EST|length=701bp
GAGGGTGTACTCTGAATGCCCTCAGCCTAGCTCTTTGAGAAGGCAACAGC
TCATTAGGGAGTGCCCTATTCTTTCTAATATTGAGCCCAAACAGATCAAA
GTTTGGTTTCAAAACCGCAGATGTCGCGAAAAGCAGAGAAAGGAAGCTTC
CCGACTTCAGACGGTGAATCGAAAGCTGAGTGCCATGAACAAGCTGTTGA
TGGAAGAGAATGACCGTCTGCAGAAGCAGGTCTCGCATTTAGTCTATGAA
AACGGATACATGCGACAGCAACTGCATAGTGCACCTGCAACGACCACAGA
CAATAGCTGTGAGTCTGTGGTCATGAGTGGTCAGCACCAACAACAGCAAA
ACCCAACACCTCAGCATCCCCAAAGGGATGCTAGCAACCCAGCTGGTCTT
CTCGCAGTAGCTGAGGAGACCCTGGCAGAGTTCCTCTCCAAGGCTACTGG
AACTGCTGTCGACTGGGTCCAGATGATTGGGATGAAGCCTGGTCCGGATT
CTATTGGTATTGTTGCTGTTTCCCGCAACTGTAGTGGAGTAGCAGCACGT
GCTTGCGGTCTCGTGAGTCTAGATCCCACAAAGATCGCTGAAATTCTCAA
AGATTGTCCATCTTGGTTTCGTGACTGTCGCTGCCTGGATGTCTTGAGCG
TGATTCCTACTGGAAATGGAGGGACAATTGAACTTATTTACATGCAGACC
T
back to top