FC920670

Overview
NameFC920670
Unique NameFC920670
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length715
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15347 contig Ccv1_Contig15347:47..762. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920670 vs. ExPASy Swiss-Prot
Match: ADK2_ARATH (Adenosine kinase 2 OS=Arabidopsis thaliana GN=ADK2 PE=1 SV=1)

HSP 1 Score: 333.569 bits (854), Expect = 6.502e-91
Identity = 164/201 (81.59%), Postives = 183/201 (91.04%), Query Frame = 2
Query:   68 ASMAYEGILLGMGNPLLDISAVVDEEFLKKYDIKSNNAILAEDKHLPMYDELASKENVEYIAGGATQNSIKVAQWMLQIPGATSYIGCIGKDKFGEEMKKNSTAAGVNVKYYEDESAPTGTCAVCVVGGERSLVANLSAANCYKSEHLKRPEIWSIVEKAKYYYIAGFFLTVSPESIQMVAEHAAAKNKSS**TFLLHLSA 670
            +S  Y+GILLGMGNPLLDISAVVD+EFL KYDIK NNAILAEDKHLPMYDE++SK NVEYIAGGATQNSIKVAQWMLQIPGATSY+G IGKDK+GE MKK++TAAGVNV YYEDESAPTGTC VCVVGGERSL+ANLSAANCYK +HLK+PE W++VEKAK+YYIAGFFLTVSPESIQ+V+EHAAA NK     F ++LSA
Sbjct:    3 SSSNYDGILLGMGNPLLDISAVVDDEFLTKYDIKLNNAILAEDKHLPMYDEMSSKFNVEYIAGGATQNSIKVAQWMLQIPGATSYMGSIGKDKYGEAMKKDATAAGVNVHYYEDESAPTGTCGVCVVGGERSLIANLSAANCYKVDHLKKPENWALVEKAKFYYIAGFFLTVSPESIQLVSEHAAANNK----VFTMNLSA 199          
BLAST of FC920670 vs. ExPASy Swiss-Prot
Match: ADK1_ARATH (Adenosine kinase 1 OS=Arabidopsis thaliana GN=ADK1 PE=1 SV=1)

HSP 1 Score: 323.168 bits (827), Expect = 8.788e-88
Identity = 157/201 (78.11%), Postives = 179/201 (89.05%), Query Frame = 2
Query:   68 ASMAYEGILLGMGNPLLDISAVVDEEFLKKYDIKSNNAILAEDKHLPMYDELASKENVEYIAGGATQNSIKVAQWMLQIPGATSYIGCIGKDKFGEEMKKNSTAAGVNVKYYEDESAPTGTCAVCVVGGERSLVANLSAANCYKSEHLKRPEIWSIVEKAKYYYIAGFFLTVSPESIQMVAEHAAAKNKSS**TFLLHLSA 670
            AS  ++GILLGMGNPLLD+SAVVD++FL KYDIK NNAILAEDKHLPMYDE++ K NVEYIAGGATQNSIKVAQWMLQ+PGATSY+G IGKDK+GE MKK++TAAGV V YYEDE+ PTGTC VCV+GGERSL+ANLSAANCYK EHLK+PE W++VEKAK+YYIAGFFLTVSPESIQ+V EHAAA NK     F ++LSA
Sbjct:    2 ASSDFDGILLGMGNPLLDVSAVVDQQFLDKYDIKLNNAILAEDKHLPMYDEMSQKFNVEYIAGGATQNSIKVAQWMLQVPGATSYMGSIGKDKYGEAMKKDATAAGVYVHYYEDEATPTGTCGVCVLGGERSLIANLSAANCYKVEHLKKPENWALVEKAKFYYIAGFFLTVSPESIQLVREHAAANNK----VFTMNLSA 198          
BLAST of FC920670 vs. ExPASy Swiss-Prot
Match: ADK_PHYPA (Adenosine kinase OS=Physcomitrella patens GN=ADK PE=1 SV=1)

HSP 1 Score: 261.151 bits (666), Expect = 1.603e-71
Identity = 128/187 (68.45%), Postives = 150/187 (80.21%), Query Frame = 2
Query:   74 MAYEGILLGMGNPLLDISAVVDEEFLKKYDIKSNNAILAEDKHLPMYDELASKENVEYIAGGATQNSIKVAQWMLQIPGATSYIGCIGKDKFGEEMKKNSTAAGVNVKYYEDESAPTGTCAVCVVGGERSLVANLSAANCYKSEHLKRPEIWSIVEKAKYYYIAGFFLTVSPESIQMVAEHAAAKNK 634
            MA EG+LLGMGNPLLDIS VVD+ FL+KY +  NNAILAEDKHLPMY ELA+  +VEYIAGGATQN+I++AQWML    ATSY GC+GKD++G+ M K ++  GVN++Y  DE  PTGTC V VV GERSLVANLSAAN YK +HLK+PE W+ VEKAKY Y AGFFLTVSPES+  VA+HAA   K
Sbjct:    1 MASEGVLLGMGNPLLDISCVVDDAFLEKYGLTLNNAILAEDKHLPMYKELAANPDVEYIAGGATQNTIRIAQWMLGESNATSYFGCVGKDEYGDRMFKLASEGGVNIRYDVDEDLPTGTCGVLVVKGERSLVANLSAANKYKIDHLKKPENWAFVEKAKYIYSAGFFLTVSPESMMTVAKHAAETGK 187          

HSP 2 Score: 30.0314 bits (66), Expect = 1.603e-71
Identity = 10/15 (66.67%), Postives = 15/15 (100.00%), Query Frame = 1
Query:  637 FMMNLSAPFICEFFR 681
            +M+NL+APFIC+FF+
Sbjct:  189 YMINLAAPFICQFFK 203          
BLAST of FC920670 vs. ExPASy Swiss-Prot
Match: ADK_RAT (Adenosine kinase OS=Rattus norvegicus GN=Adk PE=1 SV=3)

HSP 1 Score: 238.039 bits (606), Expect = 3.718e-62
Identity = 122/198 (61.62%), Postives = 145/198 (73.23%), Query Frame = 2
Query:   83 EGILLGMGNPLLDISAVVDEEFLKKYDIKSNNAILAEDKHLPMYDELASKENVEYIAGGATQNSIKVAQWMLQIP-GATSYIGCIGKDKFGEEMKKNSTAAGVNVKYYEDESAPTGTCAVCVVGGERSLVANLSAANCYKSE-HLKRPEIWSIVEKAKYYYIAGFFLTVSPESIQMVAEHAAAKNKSS**TFLLHLSA 670
            E +L GMGNPLLDISAVVD++FL KY +K N+ ILAEDKH  ++DEL  K  VEY AGG+TQNS+KVAQWM+Q P  A ++ GCIG DKFGE +K  +  A V+  YYE    PTGTCA C+ GG RSLVANL+AANCYK E HL     W +VEKA+ YYIAGFFLTVSPES+  VA +AA  N+    TF L+LSA
Sbjct:   22 ENVLFGMGNPLLDISAVVDKDFLDKYSLKPNDQILAEDKHKELFDELVKKFKVEYHAGGSTQNSMKVAQWMIQEPHRAATFFGCIGIDKFGEILKSKAADAHVDAHYYEQNEQPTGTCAACITGGNRSLVANLAAANCYKKEKHLDLENNWMLVEKARVYYIAGFFLTVSPESVLKVARYAAENNR----TFTLNLSA 215          
BLAST of FC920670 vs. ExPASy Swiss-Prot
Match: ADK_MOUSE (Adenosine kinase OS=Mus musculus GN=Adk PE=1 SV=2)

HSP 1 Score: 235.343 bits (599), Expect = 2.410e-61
Identity = 120/198 (60.61%), Postives = 145/198 (73.23%), Query Frame = 2
Query:   83 EGILLGMGNPLLDISAVVDEEFLKKYDIKSNNAILAEDKHLPMYDELASKENVEYIAGGATQNSIKVAQWMLQIP-GATSYIGCIGKDKFGEEMKKNSTAAGVNVKYYEDESAPTGTCAVCVVGGERSLVANLSAANCYKSE-HLKRPEIWSIVEKAKYYYIAGFFLTVSPESIQMVAEHAAAKNKSS**TFLLHLSA 670
            E +L GMGNPLLDISAVVD++FL KY +K N+ ILAEDKH  ++DEL  K  VEY AGG+TQNS+KVAQW++Q P  A ++ GCIG DKFGE +K+ +  A V+  YYE    PTGTCA C+ GG RSLVANL+AANCYK E HL     W +VEKA+ YYIAGFFLTVSPES+  VA +AA  N+     F L+LSA
Sbjct:   22 ENVLFGMGNPLLDISAVVDKDFLDKYSLKPNDQILAEDKHKELFDELVKKFKVEYHAGGSTQNSMKVAQWLIQEPHKAATFFGCIGIDKFGEILKRKAADAHVDAHYYEQNEQPTGTCAACITGGNRSLVANLAAANCYKKEKHLDLERNWVLVEKARVYYIAGFFLTVSPESVLKVARYAAENNR----VFTLNLSA 215          
BLAST of FC920670 vs. ExPASy Swiss-Prot
Match: ADK_HUMAN (Adenosine kinase OS=Homo sapiens GN=ADK PE=1 SV=2)

HSP 1 Score: 233.417 bits (594), Expect = 9.158e-61
Identity = 120/198 (60.61%), Postives = 144/198 (72.73%), Query Frame = 2
Query:   83 EGILLGMGNPLLDISAVVDEEFLKKYDIKSNNAILAEDKHLPMYDELASKENVEYIAGGATQNSIKVAQWMLQIP-GATSYIGCIGKDKFGEEMKKNSTAAGVNVKYYEDESAPTGTCAVCVVGGERSLVANLSAANCYKSE-HLKRPEIWSIVEKAKYYYIAGFFLTVSPESIQMVAEHAAAKNKSS**TFLLHLSA 670
            E IL GMGNPLLDISAVVD++FL KY +K N+ ILAEDKH  ++DEL  K  VEY AGG+TQNSIKVAQWM+Q P  A ++ GCIG DKFGE +K+ +  A V+  YYE    PTGTCA C+ G  RSL+ANL+AANCYK E HL   + W +VEKA+  YIAGFFLTVSPES+  VA HA+  N+     F L+LSA
Sbjct:   23 ENILFGMGNPLLDISAVVDKDFLDKYSLKPNDQILAEDKHKELFDELVKKFKVEYHAGGSTQNSIKVAQWMIQQPHKAATFFGCIGIDKFGEILKRKAAEAHVDAHYYEQNEQPTGTCAACITGDNRSLIANLAAANCYKKEKHLDLEKNWMLVEKARVCYIAGFFLTVSPESVLKVAHHASENNR----IFTLNLSA 216          
BLAST of FC920670 vs. ExPASy Swiss-Prot
Match: ADK_CRIGR (Adenosine kinase OS=Cricetulus griseus GN=ADK PE=1 SV=2)

HSP 1 Score: 232.261 bits (591), Expect = 2.040e-60
Identity = 120/198 (60.61%), Postives = 143/198 (72.22%), Query Frame = 2
Query:   83 EGILLGMGNPLLDISAVVDEEFLKKYDIKSNNAILAEDKHLPMYDELASKENVEYIAGGATQNSIKVAQWMLQIP-GATSYIGCIGKDKFGEEMKKNSTAAGVNVKYYEDESAPTGTCAVCVVGGERSLVANLSAANCYKSE-HLKRPEIWSIVEKAKYYYIAGFFLTVSPESIQMVAEHAAAKNKSS**TFLLHLSA 670
            E +L GMGNPLLDISAVVD++FL KY +K N+ ILAE+KH  ++DEL  K  VEY AGG+TQNSIKVAQWM+Q P  A ++ GCIG DKFGE +K  +  A V+  YYE    PTGTCA C+ G  RSLVANL+AANCYK E HL     W +VEKA+ YYIAGFFLTVSPES+  VA +AA  N+     F L+LSA
Sbjct:   22 ENVLFGMGNPLLDISAVVDKDFLDKYSLKPNDQILAEEKHKELFDELVRKFKVEYHAGGSTQNSIKVAQWMIQKPHKAATFFGCIGIDKFGEILKSKAAEAHVDAHYYEQNEQPTGTCAACITGDNRSLVANLAAANCYKKEKHLDLENNWVLVEKARVYYIAGFFLTVSPESVLKVARYAAENNR----IFTLNLSA 215          
BLAST of FC920670 vs. ExPASy Swiss-Prot
Match: ADK_DICDI (Adenosine kinase OS=Dictyostelium discoideum GN=adk PE=3 SV=2)

HSP 1 Score: 172.17 bits (435), Expect = 1.693e-42
Identity = 88/181 (48.62%), Postives = 119/181 (65.75%), Query Frame = 2
Query:   92 LLGMGNPLLDISAVVDEEFLKKYDIKSNNAILAEDKHLPMYDELASKENVEYIAGGATQNSIKVAQWMLQIPGATSYIGCIGKDKFGEEMKKNSTAAGVNVKYYEDESAPTGTCAVCVVGGERSLVANLSAANCYKSEHLKRPEIWSIVEKAKYYYIAGFFLTVSPESIQMVAEHAAAKNK 634
            +L  GNPLLD+S  V+   L KY++K  NAILAEDKHLP+Y E+ S + VEYI GGA QN+ +V QWML+      Y GC+G D+    +K  + + GV  KY  D SAPTG CAV +   ERS+V NL AAN +K  H +  E+ +IV  A+++Y+ G+FLTVSP+S   + +HAA  +K
Sbjct:    6 ILCAGNPLLDLSTHVEMAILDKYELKLGNAILAEDKHLPLYGEIKSGK-VEYIPGGAAQNTSRVCQWMLKDKQTVCYTGCVGTDENATILKTATESNGVVTKYQVDSSAPTGACAVLINHKERSMVTNLGAANNFKIAHFQTEEMKAIVNSAQFFYLVGYFLTVSPDSAVHLGKHAAENDK 185          

HSP 2 Score: 21.9422 bits (45), Expect = 1.693e-42
Identity = 7/17 (41.18%), Postives = 13/17 (76.47%), Query Frame = 1
Query:  628 EQVFMMNLSAPFICEFF 678
            ++ F+  L+APF+ +FF
Sbjct:  184 DKPFLYGLAAPFLIDFF 200          
BLAST of FC920670 vs. ExPASy Swiss-Prot
Match: ADK_SCHPO (Adenosine kinase OS=Schizosaccharomyces pombe GN=ado1 PE=2 SV=2)

HSP 1 Score: 152.525 bits (384), Expect = 2.054e-36
Identity = 83/196 (42.35%), Postives = 122/196 (62.24%), Query Frame = 2
Query:   89 ILLGMGNPLLDISAVVDEEFLKKYDIKSNNAILAEDKHLPMYDELASKENVEYIAGGATQNSIKVAQWMLQIPGATSYIGCIGKDKFGEEMKKNSTAAGVNVKYYEDESAPTGTCAVCVVGGE--RSLVANLSAANCYKSEHLKRPEIWSIVEKAKYYYIAGFFLTVSPESIQMVAEHAAAKNKSS**TFLLHLSA 670
            IL G+ NPLLD     +   L+KY +KSN+A+LA +  + +Y E      V Y AGGA QNS + AQ++L  P +T + GC+G+DKF + + +++  AG+  ++  D + PTG CAV +      RSL  NL AAN YK + L++P +W  VE+AK  Y+ GF LTVSPES+  +A+HA   NK     ++++LSA
Sbjct:    5 ILFGLENPLLDYYVGGETATLEKYGLKSNDAVLASESQMGIYKEPC----VSYSAGGAAQNSCRAAQYVLP-PNSTVFAGCVGQDKFADMLLESNEKAGLRSEFSVDPTTPTGVCAVVLSNNNKNRSLCTNLGAANNYKLKDLQQPNVWKFVEEAKVIYVGGFHLTVSPESMLCLAQHANENNK----PYIMNLSA 191          
BLAST of FC920670 vs. ExPASy Swiss-Prot
Match: ADK_SCHCO (Adenosine kinase OS=Schizophyllum commune GN=ADK PE=2 SV=1)

HSP 1 Score: 144.436 bits (363), Expect = 5.595e-34
Identity = 77/193 (39.90%), Postives = 115/193 (59.59%), Query Frame = 2
Query:   92 LLGMGNPLLDISAVVDEEFLKKYDIKSNNAILAEDKHLPMYDELASKENVEYIAGGATQNSIKVAQWMLQIPGATSYIGCIGKDKFGEEMKKNSTAAGVNVKYYEDESAPTGTCAVCVVGGERSLVANLSAANCYKSEHLKRPEIWSIVEKAKYYYIAGFFLTVSPESIQMVAEHAAAKNKSS**TFLLHLSA 670
            L  MGNPLLD+     E+ L+KY +KSN+AILAE+KHL +YDE+  +  V Y+AGGA QN+ + A + L  P +  Y GC+G D   E++K  +   G++  Y   +   TG CAV + G +RSLV  L AA  ++  HL    +  +V+  ++YY+ G+F+T    S   +A  +AAK+K     F+L+ SA
Sbjct:    6 LFCMGNPLLDLQVRDGEKLLEKYGLKSNDAILAEEKHLLLYDEIVKEHEVTYVAGGAAQNAARGAAYCLP-PKSVVYTGCVGDDDLAEQLKAANKREGLDEAYLVKKGEKTGACAVIITGHDRSLVTTLRAAEKFEQSHLSSEAVAPLVDAVQFYYMEGYFVTHGLASALELAGKSAAKSK----CFVLNFSA 193          
The following BLAST results are available for this feature:
BLAST of FC920670 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 12
Match NameE-valueIdentityDescription
ADK2_ARATH6.502e-9181.59Adenosine kinase 2 OS=Arabidopsis thaliana GN=ADK2... [more]
ADK1_ARATH8.788e-8878.11Adenosine kinase 1 OS=Arabidopsis thaliana GN=ADK1... [more]
ADK_PHYPA1.603e-7168.45Adenosine kinase OS=Physcomitrella patens GN=ADK P... [more]
ADK_RAT3.718e-6261.62Adenosine kinase OS=Rattus norvegicus GN=Adk PE=1 ... [more]
ADK_MOUSE2.410e-6160.61Adenosine kinase OS=Mus musculus GN=Adk PE=1 SV=2[more]
ADK_HUMAN9.158e-6160.61Adenosine kinase OS=Homo sapiens GN=ADK PE=1 SV=2[more]
ADK_CRIGR2.040e-6060.61Adenosine kinase OS=Cricetulus griseus GN=ADK PE=1... [more]
ADK_DICDI1.693e-4248.62Adenosine kinase OS=Dictyostelium discoideum GN=ad... [more]
ADK_SCHPO2.054e-3642.35Adenosine kinase OS=Schizosaccharomyces pombe GN=a... [more]
ADK_SCHCO5.595e-3439.90Adenosine kinase OS=Schizophyllum commune GN=ADK P... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32011E06EF RVDevelop1 Citrus clementina cDNA clone C32011E06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920670 ID=FC920670|Name=FC920670|organism=Citrus clementina|type=EST|length=715bp
GAGTTGCACCAAGTGAGATCTTCCCATTGAACTGAGCTTGTTAGTTGATC
TCTTTGTAAAATCTTTTGCATCAATGGCGTACGAAGGGATCCTGTTGGGC
ATGGGAAACCCACTTCTTGACATTTCAGCGGTTGTCGACGAAGAGTTCTT
GAAAAAATATGACATCAAGTCGAACAATGCTATTCTTGCTGAAGACAAGC
ACTTGCCCATGTATGATGAATTAGCTTCCAAAGAAAATGTGGAGTATATT
GCTGGGGGTGCTACACAAAATTCAATCAAAGTTGCCCAGTGGATGCTCCA
AATTCCTGGTGCTACTAGTTACATCGGCTGCATTGGAAAGGATAAGTTTG
GAGAGGAGATGAAGAAAAACTCAACAGCTGCTGGTGTCAATGTAAAATAC
TACGAGGATGAATCTGCACCAACAGGGACATGTGCTGTTTGTGTTGTTGG
TGGTGAGAGGTCACTTGTGGCCAACTTGTCAGCTGCAAATTGTTACAAAT
CTGAGCACTTGAAGAGACCTGAAATATGGTCAATAGTTGAAAAGGCAAAA
TATTACTACATTGCTGGGTTTTTCCTTACCGTGTCTCCTGAGTCCATTCA
AATGGTTGCTGAACACGCTGCTGCTAAGAACAAGTCTTCATGATGAACCT
TTCTGCTCCATTTATCTGCGAGTTCTTCAGGGGAACACAGGAGAAAGCAT
TACGTACATGGACTA
back to top