FC920672

Overview
NameFC920672
Unique NameFC920672
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length748
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14102 contig Ccv1_Contig14102:4..752. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920672 vs. ExPASy Swiss-Prot
Match: PRS7_PRUPE (26S protease regulatory subunit 7 OS=Prunus persica GN=RPT1 PE=2 SV=1)

HSP 1 Score: 399.053 bits (1024), Expect = 6.941e-111
Identity = 197/203 (97.04%), Postives = 201/203 (99.01%), Query Frame = 1
Query:   70 MAPEPEDEIKDEKNPRPLDEDDIALLKTYGLGPYSTSIKKAEKEIKDMAKKVNDLCGIKESDTGLAAPSQWDLVSDKQMMQEEQPLQVARCTKIISPNSEDAKYVINVKQIAKFVVGLGDKVSPTDIEEGMRVGVDRNKYQIQIPLPPKIDPSVTMMTVEEKPDVTYNDVGGCKEQIEKMREVVELPMLHPEKFVKLGIDPPR 678
            MAPEPED IKDEKNPRPLDEDDIALLKTYGLGPYST IKKAEKE+KD+AKKVNDLCGIKESDTGLAAPSQWDLVSDKQMMQEEQPLQVARCTKII+PNSEDAKYVINVKQIAKFVVGLGDKVSPTDIEEGMRVGVDRNKYQIQIPLPPKIDPSVTMMTVEEKPDVTYNDVGGCKEQIEKMREVVELPMLHPEKFVKLGIDPP+
Sbjct:    1 MAPEPED-IKDEKNPRPLDEDDIALLKTYGLGPYSTHIKKAEKEVKDLAKKVNDLCGIKESDTGLAAPSQWDLVSDKQMMQEEQPLQVARCTKIINPNSEDAKYVINVKQIAKFVVGLGDKVSPTDIEEGMRVGVDRNKYQIQIPLPPKIDPSVTMMTVEEKPDVTYNDVGGCKEQIEKMREVVELPMLHPEKFVKLGIDPPK 202          

HSP 2 Score: 23.483 bits (49), Expect = 6.941e-111
Identity = 12/21 (57.14%), Postives = 14/21 (66.67%), Query Frame = 3
Query:  675 KGVLCYGPLAL-VNIYSRAVA 734
            KGVLCYGP      + +RAVA
Sbjct:  202 KGVLCYGPPGTGKTLLARAVA 222          
BLAST of FC920672 vs. ExPASy Swiss-Prot
Match: PRS7_ORYSJ (26S protease regulatory subunit 7 OS=Oryza sativa subsp. japonica GN=RPT1A PE=2 SV=1)

HSP 1 Score: 397.127 bits (1019), Expect = 2.625e-110
Identity = 193/203 (95.07%), Postives = 200/203 (98.52%), Query Frame = 1
Query:   70 MAPEPEDEIKDEKNPRPLDEDDIALLKTYGLGPYSTSIKKAEKEIKDMAKKVNDLCGIKESDTGLAAPSQWDLVSDKQMMQEEQPLQVARCTKIISPNSEDAKYVINVKQIAKFVVGLGDKVSPTDIEEGMRVGVDRNKYQIQIPLPPKIDPSVTMMTVEEKPDVTYNDVGGCKEQIEKMREVVELPMLHPEKFVKLGIDPPR 678
            MAPEPED+I +EKNPRPLDEDDIALLKTYGLGPYSTSIKK EKEIK+MAKK+NDLCGIKESDTGLA PSQWDLVSDKQMMQEEQPLQVARCTKIISPN++DAKYVINVKQIAKFVVGLGDKVSPTDIEEGMRVGVDRNKYQIQIPLPPKIDPSVTMMTVEEKPDVTYNDVGGCKEQIEKMREVVELPMLHPEKFVKLGIDPP+
Sbjct:    1 MAPEPEDDIMNEKNPRPLDEDDIALLKTYGLGPYSTSIKKVEKEIKEMAKKINDLCGIKESDTGLAPPSQWDLVSDKQMMQEEQPLQVARCTKIISPNTDDAKYVINVKQIAKFVVGLGDKVSPTDIEEGMRVGVDRNKYQIQIPLPPKIDPSVTMMTVEEKPDVTYNDVGGCKEQIEKMREVVELPMLHPEKFVKLGIDPPK 203          

HSP 2 Score: 23.483 bits (49), Expect = 2.625e-110
Identity = 12/21 (57.14%), Postives = 14/21 (66.67%), Query Frame = 3
Query:  675 KGVLCYGPLAL-VNIYSRAVA 734
            KGVLCYGP      + +RAVA
Sbjct:  203 KGVLCYGPPGTGKTLLARAVA 223          
BLAST of FC920672 vs. ExPASy Swiss-Prot
Match: PRS7_SPIOL (26S protease regulatory subunit 7 OS=Spinacia oleracea GN=RPT1 PE=2 SV=1)

HSP 1 Score: 390.193 bits (1001), Expect = 3.152e-108
Identity = 192/203 (94.58%), Postives = 198/203 (97.54%), Query Frame = 1
Query:   70 MAPEPEDEIKDEKNPRPLDEDDIALLKTYGLGPYSTSIKKAEKEIKDMAKKVNDLCGIKESDTGLAAPSQWDLVSDKQMMQEEQPLQVARCTKIISPNSEDAKYVINVKQIAKFVVGLGDKVSPTDIEEGMRVGVDRNKYQIQIPLPPKIDPSVTMMTVEEKPDVTYNDVGGCKEQIEKMREVVELPMLHPEKFVKLGIDPPR 678
            MA E ED++KDEKNPRPLDEDDIALLKTYGLGPYS SIKK EKEIKDM+KKVNDL GIKESDTGLAAPSQWDLVSDKQMMQEEQPLQVARCTKII+PN+EDAKYVINVKQIAKFVVGLGDKVSPTDIEEGMRVGVDRNKYQIQIPLPPKIDPSVTMMTVEEKPDVTYNDVGGCKEQIEKMREVVELPMLHPEKFVKLGIDPP+
Sbjct:    1 MAIEHEDDLKDEKNPRPLDEDDIALLKTYGLGPYSASIKKVEKEIKDMSKKVNDLIGIKESDTGLAAPSQWDLVSDKQMMQEEQPLQVARCTKIINPNTEDAKYVINVKQIAKFVVGLGDKVSPTDIEEGMRVGVDRNKYQIQIPLPPKIDPSVTMMTVEEKPDVTYNDVGGCKEQIEKMREVVELPMLHPEKFVKLGIDPPK 203          

HSP 2 Score: 23.483 bits (49), Expect = 3.152e-108
Identity = 12/21 (57.14%), Postives = 14/21 (66.67%), Query Frame = 3
Query:  675 KGVLCYGPLAL-VNIYSRAVA 734
            KGVLCYGP      + +RAVA
Sbjct:  203 KGVLCYGPPGTGKTLLARAVA 223          
BLAST of FC920672 vs. ExPASy Swiss-Prot
Match: PRS7A_ARATH (26S protease regulatory subunit 7 homolog A OS=Arabidopsis thaliana GN=RPT1A PE=2 SV=1)

HSP 1 Score: 389.037 bits (998), Expect = 7.001e-108
Identity = 190/203 (93.60%), Postives = 196/203 (96.55%), Query Frame = 1
Query:   70 MAPEPEDEIKDEKNPRPLDEDDIALLKTYGLGPYSTSIKKAEKEIKDMAKKVNDLCGIKESDTGLAAPSQWDLVSDKQMMQEEQPLQVARCTKIISPNSEDAKYVINVKQIAKFVVGLGDKVSPTDIEEGMRVGVDRNKYQIQIPLPPKIDPSVTMMTVEEKPDVTYNDVGGCKEQIEKMREVVELPMLHPEKFVKLGIDPPR 678
            M  + EDEI+DEKNPRPLDEDDIALLKTYGLGPYS  IKK EKEIKD+AKK+NDLCGIKESDTGLA PSQWDLVSDKQMMQEEQPLQVARCTKIISPN+EDAKYVINVKQIAKFVVGLGDKVSPTDIEEGMRVGVDRNKYQIQIPLPPKIDPSVTMMTVEEKPDVTYNDVGGCKEQIEKMREVVELPMLHPEKFVKLGIDPP+
Sbjct:    1 MVRDIEDEIRDEKNPRPLDEDDIALLKTYGLGPYSAPIKKVEKEIKDLAKKINDLCGIKESDTGLAPPSQWDLVSDKQMMQEEQPLQVARCTKIISPNTEDAKYVINVKQIAKFVVGLGDKVSPTDIEEGMRVGVDRNKYQIQIPLPPKIDPSVTMMTVEEKPDVTYNDVGGCKEQIEKMREVVELPMLHPEKFVKLGIDPPK 203          

HSP 2 Score: 23.483 bits (49), Expect = 7.001e-108
Identity = 12/21 (57.14%), Postives = 14/21 (66.67%), Query Frame = 3
Query:  675 KGVLCYGPLAL-VNIYSRAVA 734
            KGVLCYGP      + +RAVA
Sbjct:  203 KGVLCYGPPGTGKTLLARAVA 223          
BLAST of FC920672 vs. ExPASy Swiss-Prot
Match: PRS7_DICDI (26S protease regulatory subunit 7 OS=Dictyostelium discoideum GN=psmC2 PE=1 SV=1)

HSP 1 Score: 306.22 bits (783), Expect = 1.210e-82
Identity = 148/198 (74.75%), Postives = 167/198 (84.34%), Query Frame = 1
Query:   85 EDEIKDEKNPRPLDEDDIALLKTYGLGPYSTSIKKAEKEIKDMAKKVNDLCGIKESDTGLAAPSQWDLVSDKQMMQEEQPLQVARCTKIISPNSEDAKYVINVKQIAKFVVGLGDKVSPTDIEEGMRVGVDRNKYQIQIPLPPKIDPSVTMMTVEEKPDVTYNDVGGCKEQIEKMREVVELPMLHPEKFVKLGIDPPR 678
            EDE+ +E  P  LDE DIALLK+YG+GPYS SI+  E++IK M  KVN+LCGIKESDTG+  PSQWDLV DK    EE PLQVARCTKII     +AKY+I VKQIAKFVV LGDK+SPTD+EEG+RVGVDRNKYQIQIPLPPKID SVTMM VEEKPD+TY DVGGCKEQIEK+REVVE+P+LHPEKFV LGIDPP+
Sbjct:    8 EDELLNETAPVALDEGDIALLKSYGVGPYSKSIRILEEDIKKMTSKVNELCGIKESDTGIGPPSQWDLVVDKTSAHEEPPLQVARCTKIIDVGKPNAKYIITVKQIAKFVVALGDKLSPTDVEEGIRVGVDRNKYQIQIPLPPKIDASVTMMQVEEKPDITYKDVGGCKEQIEKLREVVEMPLLHPEKFVNLGIDPPK 205          
BLAST of FC920672 vs. ExPASy Swiss-Prot
Match: PRS7_MOUSE (26S protease regulatory subunit 7 OS=Mus musculus GN=Psmc2 PE=1 SV=5)

HSP 1 Score: 301.212 bits (770), Expect = 3.893e-81
Identity = 145/198 (73.23%), Postives = 169/198 (85.35%), Query Frame = 1
Query:   85 EDEIKDEKNPRPLDEDDIALLKTYGLGPYSTSIKKAEKEIKDMAKKVNDLCGIKESDTGLAAPSQWDLVSDKQMMQEEQPLQVARCTKIISPNSEDAKYVINVKQIAKFVVGLGDKVSPTDIEEGMRVGVDRNKYQIQIPLPPKIDPSVTMMTVEEKPDVTYNDVGGCKEQIEKMREVVELPMLHPEKFVKLGIDPPR 678
            ++E KD+K  R LDE DIALLKTYG   YS  IK+ E +I+ + KK+N+L GIKESDTGLA P+ WDL +DKQ +Q EQPLQVARCTKII+ +SED KY+INVKQ AKFVV L D+V+PTDIEEGMRVGVDRNKYQI IPLPPKIDP+VTMM VEEKPDVTY+DVGGCKEQIEK+REVVE P+LHPE+FV LGI+PP+
Sbjct:   13 KEEEKDDKPIRALDEGDIALLKTYGQSTYSRQIKQVEDDIQQLLKKINELTGIKESDTGLAPPALWDLAADKQTLQSEQPLQVARCTKIINADSEDPKYIINVKQFAKFVVDLSDQVAPTDIEEGMRVGVDRNKYQIHIPLPPKIDPTVTMMQVEEKPDVTYSDVGGCKEQIEKLREVVETPLLHPERFVNLGIEPPK 210          
BLAST of FC920672 vs. ExPASy Swiss-Prot
Match: PRS7_RAT (26S protease regulatory subunit 7 OS=Rattus norvegicus GN=Psmc2 PE=1 SV=3)

HSP 1 Score: 300.827 bits (769), Expect = 5.085e-81
Identity = 147/198 (74.24%), Postives = 169/198 (85.35%), Query Frame = 1
Query:   85 EDEIKDEKNPRPLDEDDIALLKTYGLGPYSTSIKKAEKEIKDMAKKVNDLCGIKESDTGLAAPSQWDLVSDKQMMQEEQPLQVARCTKIISPNSEDAKYVINVKQIAKFVVGLGDKVSPTDIEEGMRVGVDRNKYQIQIPLPPKIDPSVTMMTVEEKPDVTYNDVGGCKEQIEKMREVVELPMLHPEKFVKLGIDPPR 678
            EDE KD+K  R LDE DIALLKTYG   YS  IK+ E +I+ + KK+N+L GIKESDTGLA P+ WDL +DKQ +Q EQPLQVARCTKII+ +SED KY+INVKQ AKFVV L D+V+PTDIEEGMRVGVDRNKYQI IPLPPKIDP+VTMM VEEKPDVTY+DVGGCKEQIEK+REVVE P+LHPE+FV LGI+PP+
Sbjct:   14 EDE-KDDKPIRALDEGDIALLKTYGQSTYSRQIKQVEDDIQQLLKKINELTGIKESDTGLAPPALWDLAADKQTLQSEQPLQVARCTKIINADSEDPKYIINVKQFAKFVVDLSDQVAPTDIEEGMRVGVDRNKYQIHIPLPPKIDPTVTMMQVEEKPDVTYSDVGGCKEQIEKLREVVETPLLHPERFVNLGIEPPK 210          
BLAST of FC920672 vs. ExPASy Swiss-Prot
Match: PRS7_PONAB (26S protease regulatory subunit 7 OS=Pongo abelii GN=PSMC2 PE=2 SV=3)

HSP 1 Score: 300.827 bits (769), Expect = 5.085e-81
Identity = 147/198 (74.24%), Postives = 169/198 (85.35%), Query Frame = 1
Query:   85 EDEIKDEKNPRPLDEDDIALLKTYGLGPYSTSIKKAEKEIKDMAKKVNDLCGIKESDTGLAAPSQWDLVSDKQMMQEEQPLQVARCTKIISPNSEDAKYVINVKQIAKFVVGLGDKVSPTDIEEGMRVGVDRNKYQIQIPLPPKIDPSVTMMTVEEKPDVTYNDVGGCKEQIEKMREVVELPMLHPEKFVKLGIDPPR 678
            EDE KD+K  R LDE DIALLKTYG   YS  IK+ E +I+ + KK+N+L GIKESDTGLA P+ WDL +DKQ +Q EQPLQVARCTKII+ +SED KY+INVKQ AKFVV L D+V+PTDIEEGMRVGVDRNKYQI IPLPPKIDP+VTMM VEEKPDVTY+DVGGCKEQIEK+REVVE P+LHPE+FV LGI+PP+
Sbjct:   14 EDE-KDDKPIRALDEGDIALLKTYGQSTYSRQIKQVEDDIQQLLKKINELTGIKESDTGLAPPALWDLAADKQTLQSEQPLQVARCTKIITADSEDPKYIINVKQFAKFVVDLSDQVAPTDIEEGMRVGVDRNKYQIHIPLPPKIDPTVTMMQVEEKPDVTYSDVGGCKEQIEKLREVVETPLLHPERFVNLGIEPPK 210          
BLAST of FC920672 vs. ExPASy Swiss-Prot
Match: PRS7_MACFA (26S protease regulatory subunit 7 OS=Macaca fascicularis GN=PSMC2 PE=2 SV=3)

HSP 1 Score: 300.827 bits (769), Expect = 5.085e-81
Identity = 147/198 (74.24%), Postives = 169/198 (85.35%), Query Frame = 1
Query:   85 EDEIKDEKNPRPLDEDDIALLKTYGLGPYSTSIKKAEKEIKDMAKKVNDLCGIKESDTGLAAPSQWDLVSDKQMMQEEQPLQVARCTKIISPNSEDAKYVINVKQIAKFVVGLGDKVSPTDIEEGMRVGVDRNKYQIQIPLPPKIDPSVTMMTVEEKPDVTYNDVGGCKEQIEKMREVVELPMLHPEKFVKLGIDPPR 678
            EDE KD+K  R LDE DIALLKTYG   YS  IK+ E +I+ + KK+N+L GIKESDTGLA P+ WDL +DKQ +Q EQPLQVARCTKII+ +SED KY+INVKQ AKFVV L D+V+PTDIEEGMRVGVDRNKYQI IPLPPKIDP+VTMM VEEKPDVTY+DVGGCKEQIEK+REVVE P+LHPE+FV LGI+PP+
Sbjct:   14 EDE-KDDKPIRALDEGDIALLKTYGQSTYSRQIKQVEDDIQQLLKKINELTGIKESDTGLAPPALWDLAADKQTLQSEQPLQVARCTKIINADSEDPKYIINVKQFAKFVVDLSDQVAPTDIEEGMRVGVDRNKYQIHIPLPPKIDPTVTMMQVEEKPDVTYSDVGGCKEQIEKLREVVETPLLHPERFVNLGIEPPK 210          
BLAST of FC920672 vs. ExPASy Swiss-Prot
Match: PRS7_HUMAN (26S protease regulatory subunit 7 OS=Homo sapiens GN=PSMC2 PE=1 SV=3)

HSP 1 Score: 300.827 bits (769), Expect = 5.085e-81
Identity = 147/198 (74.24%), Postives = 169/198 (85.35%), Query Frame = 1
Query:   85 EDEIKDEKNPRPLDEDDIALLKTYGLGPYSTSIKKAEKEIKDMAKKVNDLCGIKESDTGLAAPSQWDLVSDKQMMQEEQPLQVARCTKIISPNSEDAKYVINVKQIAKFVVGLGDKVSPTDIEEGMRVGVDRNKYQIQIPLPPKIDPSVTMMTVEEKPDVTYNDVGGCKEQIEKMREVVELPMLHPEKFVKLGIDPPR 678
            EDE KD+K  R LDE DIALLKTYG   YS  IK+ E +I+ + KK+N+L GIKESDTGLA P+ WDL +DKQ +Q EQPLQVARCTKII+ +SED KY+INVKQ AKFVV L D+V+PTDIEEGMRVGVDRNKYQI IPLPPKIDP+VTMM VEEKPDVTY+DVGGCKEQIEK+REVVE P+LHPE+FV LGI+PP+
Sbjct:   14 EDE-KDDKPIRALDEGDIALLKTYGQSTYSRQIKQVEDDIQQLLKKINELTGIKESDTGLAPPALWDLAADKQTLQSEQPLQVARCTKIINADSEDPKYIINVKQFAKFVVDLSDQVAPTDIEEGMRVGVDRNKYQIHIPLPPKIDPTVTMMQVEEKPDVTYSDVGGCKEQIEKLREVVETPLLHPERFVNLGIEPPK 210          
The following BLAST results are available for this feature:
BLAST of FC920672 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 109
Match NameE-valueIdentityDescription
PRS7_PRUPE6.941e-11197.0426S protease regulatory subunit 7 OS=Prunus persic... [more]
PRS7_ORYSJ2.625e-11095.0726S protease regulatory subunit 7 OS=Oryza sativa ... [more]
PRS7_SPIOL3.152e-10894.5826S protease regulatory subunit 7 OS=Spinacia oler... [more]
PRS7A_ARATH7.001e-10893.6026S protease regulatory subunit 7 homolog A OS=Ara... [more]
PRS7_DICDI1.210e-8274.7526S protease regulatory subunit 7 OS=Dictyostelium... [more]
PRS7_MOUSE3.893e-8173.2326S protease regulatory subunit 7 OS=Mus musculus ... [more]
PRS7_RAT5.085e-8174.2426S protease regulatory subunit 7 OS=Rattus norveg... [more]
PRS7_PONAB5.085e-8174.2426S protease regulatory subunit 7 OS=Pongo abelii ... [more]
PRS7_MACFA5.085e-8174.2426S protease regulatory subunit 7 OS=Macaca fascic... [more]
PRS7_HUMAN5.085e-8174.2426S protease regulatory subunit 7 OS=Homo sapiens ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32011E08EF RVDevelop1 Citrus clementina cDNA clone C32011E08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920672 ID=FC920672|Name=FC920672|organism=Citrus clementina|type=EST|length=748bp
GGCACTTTTATTTCTCCGCAAGCCATCTTAAATCTTCAGTCTTCCAAGCT
AGCAAAGGAAAGCAAAGCCATGGCACCGGAGCCGGAAGATGAGATCAAGG
ACGAGAAAAACCCTAGGCCTCTCGATGAAGACGATATCGCTCTTCTCAAA
ACCTATGGTTTAGGACCTTATTCTACTAGCATTAAGAAAGCGGAGAAAGA
AATAAAGGATATGGCCAAGAAGGTCAATGACCTGTGTGGTATCAAGGAGT
CTGATACGGGATTAGCTGCACCTAGCCAGTGGGATCTTGTGTCGGATAAG
CAGATGATGCAAGAGGAACAGCCGCTTCAGGTAGCAAGATGCACCAAGAT
AATCAGTCCAAACTCTGAAGATGCCAAATATGTTATAAATGTTAAGCAGA
TTGCAAAGTTTGTTGTTGGGCTTGGTGATAAAGTTTCCCCAACGGATATA
GAAGAGGGCATGCGTGTGGGGGTTGACAGAAATAAATATCAGATTCAAAT
TCCCTTGCCTCCAAAAATTGATCCAAGTGTGACCATGATGACCGTGGAAG
AGAAGCCAGATGTTACATATAATGATGTTGGCGGATGCAAGGAGCAGATT
GAAAAGATGCGAGAAGTTGTTGAGCTACCTATGCTTCATCCTGAGAAATT
TGTAAAGCTTGGAATTGATCCTCCAAGGGTGTTCTATGCTATGGTCCTCT
GGCACTGGTAAACATTTATAGCAGAGCTGTAGCTACAGAACCGATGCT
back to top