FC920677

Overview
NameFC920677
Unique NameFC920677
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length489
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15279 contig Ccv1_Contig15279:575..1063. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920677 vs. ExPASy Swiss-Prot
Match: METE_ARATH (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Arabidopsis thaliana GN=CIMS PE=1 SV=1)

HSP 1 Score: 304.294 bits (778), Expect = 1.886e-82
Identity = 142/153 (92.81%), Postives = 149/153 (97.39%), Query Frame = 2
Query:    2 LSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKAMTVFWSSLAQSMTARPMKGMLTGPVTILNWSFVRNDQPRHETCYQIALAIKDEVEDLEKAGINVIQIDEAALREGLPLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFTTL 460
            LSGFAFTANGWVQSYGSRCVKPP+IYGDVSRPKAMTVFWS++AQSMT+RPMKGMLTGPVTILNWSFVRNDQPRHETCYQIALAIKDEVEDLEK GI VIQIDEAALREGLPLRKSEHAFYLDWAVHSFRITNCGVQD+TQIHTHMCYS+F  +
Sbjct:  504 LSGFAFTANGWVQSYGSRCVKPPVIYGDVSRPKAMTVFWSAMAQSMTSRPMKGMLTGPVTILNWSFVRNDQPRHETCYQIALAIKDEVEDLEKGGIGVIQIDEAALREGLPLRKSEHAFYLDWAVHSFRITNCGVQDSTQIHTHMCYSHFNDI 656          
BLAST of FC920677 vs. ExPASy Swiss-Prot
Match: METE_SOLSC (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Solenostemon scutellarioides GN=MET PE=1 SV=2)

HSP 1 Score: 298.516 bits (763), Expect = 1.035e-80
Identity = 143/153 (93.46%), Postives = 145/153 (94.77%), Query Frame = 2
Query:    2 LSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKAMTVFWSSLAQSMTARPMKGMLTGPVTILNWSFVRNDQPRHETCYQIALAIKDEVEDLEKAGINVIQIDEAALREGLPLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFTTL 460
            LSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPK MTVFWS+ AQSMT RPMKGMLTGPVTILNWSFVRNDQPR ETCYQIALAIKDEVEDLEKAGI VIQIDEAALREGLPLRKSEHAFYLDWAVHSFRITN GVQDTTQIHTHMCYSNF  +
Sbjct:  503 LSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTVFWSTAAQSMTQRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKAGITVIQIDEAALREGLPLRKSEHAFYLDWAVHSFRITNVGVQDTTQIHTHMCYSNFNDI 655          
BLAST of FC920677 vs. ExPASy Swiss-Prot
Match: METE_MESCR (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Mesembryanthemum crystallinum GN=METE PE=2 SV=1)

HSP 1 Score: 298.13 bits (762), Expect = 1.352e-80
Identity = 142/153 (92.81%), Postives = 146/153 (95.42%), Query Frame = 2
Query:    2 LSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKAMTVFWSSLAQSMTARPMKGMLTGPVTILNWSFVRNDQPRHETCYQIALAIKDEVEDLEKAGINVIQIDEAALREGLPLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFTTL 460
            LSGFAF+ANGWVQSYGSRCVKPPIIYGDVSRP  MTVFWSS+AQSMTARPMKGMLTGPVTILNWSFVRNDQPRHETCYQIALAIK+EVEDLEKAGINVIQIDEAALREGLPLRKSEH FYL WAVHSFRITN GVQDTTQIHTHMCYSNF  +
Sbjct:  504 LSGFAFSANGWVQSYGSRCVKPPIIYGDVSRPNPMTVFWSSMAQSMTARPMKGMLTGPVTILNWSFVRNDQPRHETCYQIALAIKNEVEDLEKAGINVIQIDEAALREGLPLRKSEHDFYLKWAVHSFRITNVGVQDTTQIHTHMCYSNFNDI 656          
BLAST of FC920677 vs. ExPASy Swiss-Prot
Match: METE_CATRO (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Catharanthus roseus GN=METE PE=2 SV=1)

HSP 1 Score: 293.123 bits (749), Expect = 4.348e-79
Identity = 140/153 (91.50%), Postives = 143/153 (93.46%), Query Frame = 2
Query:    2 LSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKAMTVFWSSLAQSMTARPMKGMLTGPVTILNWSFVRNDQPRHETCYQIALAIKDEVEDLEKAGINVIQIDEAALREGLPLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFTTL 460
            LSGFAFTANGWVQSYGSRCVKPPIIYGDVSRP  MTVFWS  AQSMT RPMKGMLTGPVTILNWSFVRNDQPR ETCYQIALAIKDEVEDLEKAGINVIQIDEAALREGLPLRK+EHAFYLDWAVHSFRITN  +QDTTQIHTHMCYSNF  +
Sbjct:  504 LSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPNPMTVFWSQTAQSMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEKAGINVIQIDEAALREGLPLRKAEHAFYLDWAVHSFRITNLPLQDTTQIHTHMCYSNFNDI 656          
BLAST of FC920677 vs. ExPASy Swiss-Prot
Match: METE_FLAJ1 (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=metE PE=3 SV=1)

HSP 1 Score: 240.736 bits (613), Expect = 2.561e-63
Identity = 115/157 (73.25%), Postives = 128/157 (81.53%), Query Frame = 2
Query:    2 LSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKAMTVFWSSLAQSMTARPMKGMLTGPVTILNWSFVRNDQPRHETCYQIALAIKDEVEDLEKAGINVIQIDEAALREGLPLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFTTLSTHI 472
            L GF FT NGWVQSYGSRCVKPP+IYGDVSRP  MTV WS  AQS+T++ +KGMLTGPVTIL WSFVRNDQPR ETC QIALA++DEV DLEKAGI +IQIDE A+REGLPLRK E A YLDWAV +FRI+  GV D TQIH HMCYS F  +  +I
Sbjct:  512 LDGFTFTKNGWVQSYGSRCVKPPVIYGDVSRPNPMTVKWSKYAQSLTSKWVKGMLTGPVTILQWSFVRNDQPRSETCTQIALAVRDEVVDLEKAGIKIIQIDEPAIREGLPLRKEEWAKYLDWAVKAFRISASGVNDDTQIHPHMCYSEFNDIIQNI 668          
BLAST of FC920677 vs. ExPASy Swiss-Prot
Match: METE_BURCM (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=metE PE=3 SV=1)

HSP 1 Score: 240.736 bits (613), Expect = 2.561e-63
Identity = 114/157 (72.61%), Postives = 132/157 (84.08%), Query Frame = 2
Query:    2 LSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKAMTVFWSSLAQSMTARPMKGMLTGPVTILNWSFVRNDQPRHETCYQIALAIKDEVEDLEKAGINVIQIDEAALREGLPLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFTTLSTHI 472
            L G+AF+  GWVQSYGSRCVKPPI++GD+SRPKAMTV W + AQS+T +PMKGMLTGPVTILNWSFVR+DQPR  +CYQ+ALAI+DEV DLEKAG+ VIQIDEAALREGLPLR+++   YL WAV +FRIT  GVQD TQIHTHMCYS F  +   I
Sbjct:  507 LDGYAFSQFGWVQSYGSRCVKPPILFGDISRPKAMTVEWITYAQSLTNKPMKGMLTGPVTILNWSFVRDDQPRSVSCYQLALAIRDEVLDLEKAGVRVIQIDEAALREGLPLRRAQWGEYLKWAVEAFRITANGVQDDTQIHTHMCYSEFNDIIASI 663          
BLAST of FC920677 vs. ExPASy Swiss-Prot
Match: METE_BURCJ (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Burkholderia cepacia (strain J2315 / LMG 16656) GN=metE PE=3 SV=1)

HSP 1 Score: 240.736 bits (613), Expect = 2.561e-63
Identity = 114/157 (72.61%), Postives = 133/157 (84.71%), Query Frame = 2
Query:    2 LSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKAMTVFWSSLAQSMTARPMKGMLTGPVTILNWSFVRNDQPRHETCYQIALAIKDEVEDLEKAGINVIQIDEAALREGLPLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFTTLSTHI 472
            L G+AF+  GWVQSYGSRCVKPPI++GD+SRPKAMTV W + AQS+T +PMKGMLTGPVTILNWSFVR+DQPR  +CYQ+ALAI+DEV DLE+AG+ VIQIDEAALREGLPLR+++ + YL WAV SFRIT  GVQD TQIHTHMCYS F  +   I
Sbjct:  507 LDGYAFSQFGWVQSYGSRCVKPPILFGDISRPKAMTVEWITYAQSLTNKPMKGMLTGPVTILNWSFVRDDQPRSVSCYQLALAIRDEVLDLEQAGVRVIQIDEAALREGLPLRRAQWSEYLKWAVESFRITANGVQDDTQIHTHMCYSEFNDIIASI 663          
BLAST of FC920677 vs. ExPASy Swiss-Prot
Match: METE_BURCH (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Burkholderia cenocepacia (strain HI2424) GN=metE PE=3 SV=1)

HSP 1 Score: 240.736 bits (613), Expect = 2.561e-63
Identity = 114/157 (72.61%), Postives = 133/157 (84.71%), Query Frame = 2
Query:    2 LSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKAMTVFWSSLAQSMTARPMKGMLTGPVTILNWSFVRNDQPRHETCYQIALAIKDEVEDLEKAGINVIQIDEAALREGLPLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFTTLSTHI 472
            L G+AF+  GWVQSYGSRCVKPPI++GD+SRPKAMTV W + AQS+T +PMKGMLTGPVTILNWSFVR+DQPR  +CYQ+ALAI++EV DLEKAG+ VIQIDEAALREGLPLR+++ + YL WAV SFRIT  GVQD TQIHTHMCYS F  +   I
Sbjct:  507 LDGYAFSQFGWVQSYGSRCVKPPILFGDISRPKAMTVEWIAYAQSLTRKPMKGMLTGPVTILNWSFVRDDQPRAVSCYQLALAIREEVLDLEKAGVRVIQIDEAALREGLPLRRAQWSEYLKWAVESFRITANGVQDDTQIHTHMCYSEFNDIIASI 663          
BLAST of FC920677 vs. ExPASy Swiss-Prot
Match: METE_BURCC (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Burkholderia cenocepacia (strain MC0-3) GN=metE PE=3 SV=1)

HSP 1 Score: 240.736 bits (613), Expect = 2.561e-63
Identity = 114/157 (72.61%), Postives = 133/157 (84.71%), Query Frame = 2
Query:    2 LSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKAMTVFWSSLAQSMTARPMKGMLTGPVTILNWSFVRNDQPRHETCYQIALAIKDEVEDLEKAGINVIQIDEAALREGLPLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFTTLSTHI 472
            L G+AF+  GWVQSYGSRCVKPPI++GD+SRPKAMTV W + AQS+T +PMKGMLTGPVTILNWSFVR+DQPR  +CYQ+ALAI++EV DLEKAG+ VIQIDEAALREGLPLR+++ + YL WAV SFRIT  GVQD TQIHTHMCYS F  +   I
Sbjct:  507 LDGYAFSQFGWVQSYGSRCVKPPILFGDISRPKAMTVEWIAYAQSLTRKPMKGMLTGPVTILNWSFVRDDQPRAVSCYQLALAIREEVLDLEKAGVRVIQIDEAALREGLPLRRAQWSEYLKWAVESFRITANGVQDDTQIHTHMCYSEFNDIIASI 663          
BLAST of FC920677 vs. ExPASy Swiss-Prot
Match: METE_BURCA (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Burkholderia cenocepacia (strain AU 1054) GN=metE PE=3 SV=1)

HSP 1 Score: 240.736 bits (613), Expect = 2.561e-63
Identity = 114/157 (72.61%), Postives = 133/157 (84.71%), Query Frame = 2
Query:    2 LSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKAMTVFWSSLAQSMTARPMKGMLTGPVTILNWSFVRNDQPRHETCYQIALAIKDEVEDLEKAGINVIQIDEAALREGLPLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFTTLSTHI 472
            L G+AF+  GWVQSYGSRCVKPPI++GD+SRPKAMTV W + AQS+T +PMKGMLTGPVTILNWSFVR+DQPR  +CYQ+ALAI++EV DLEKAG+ VIQIDEAALREGLPLR+++ + YL WAV SFRIT  GVQD TQIHTHMCYS F  +   I
Sbjct:  507 LDGYAFSQFGWVQSYGSRCVKPPILFGDISRPKAMTVEWIAYAQSLTRKPMKGMLTGPVTILNWSFVRDDQPRAVSCYQLALAIREEVLDLEKAGVRVIQIDEAALREGLPLRRAQWSEYLKWAVESFRITANGVQDDTQIHTHMCYSEFNDIIASI 663          
The following BLAST results are available for this feature:
BLAST of FC920677 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 270
Match NameE-valueIdentityDescription
METE_ARATH1.886e-8292.815-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_SOLSC1.035e-8093.465-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_MESCR1.352e-8092.815-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_CATRO4.348e-7991.505-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_FLAJ12.561e-6373.255-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_BURCM2.561e-6372.615-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_BURCJ2.561e-6372.615-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_BURCH2.561e-6372.615-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_BURCC2.561e-6372.615-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_BURCA2.561e-6372.615-methyltetrahydropteroyltriglutamate--homocystein... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32011F03EF RVDevelop1 Citrus clementina cDNA clone C32011F03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920677 ID=FC920677|Name=FC920677|organism=Citrus clementina|type=EST|length=489bp
ATTATCAGGTTTCGCCTTCACTGCCAATGGGTGGGTGCAATCCTATGGAT
CTCGCTGTGTGAAGCCACCCATCATCTATGGTGATGTGAGCCGTCCCAAG
GCTATGACCGTCTTCTGGTCCTCCTTGGCTCAGAGCATGACAGCTCGCCC
AATGAAAGGAATGCTTACTGGCCCTGTCACCATTCTCAACTGGTCCTTTG
TTAGAAATGACCAGCCCAGACATGAAACCTGCTACCAGATTGCTTTGGCC
ATCAAGGACGAAGTCGAGGATCTTGAGAAGGCAGGCATTAACGTTATTCA
AATTGATGAGGCTGCCTTGAGGGAAGGATTGCCTCTTAGGAAATCTGAGC
ATGCTTTCTACTTGGACTGGGCAGTCCACTCCTTCAGAATCACCAACTGT
GGCGTCCAGGACACTACCCAGATCCACACCCACATGTGCTACTCCAACTT
CACGACATTATCCACTCATATCGACATGATGCTGATGTG
back to top