FC920680

Overview
NameFC920680
Unique NameFC920680
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length701
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig13706 contig Ccv1_Contig13706:54..754. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920680 vs. ExPASy Swiss-Prot
Match: IF2G_YEAST (Eukaryotic translation initiation factor 2 subunit gamma OS=Saccharomyces cerevisiae GN=GCD11 PE=1 SV=1)

HSP 1 Score: 261.922 bits (668), Expect = 2.337e-69
Identity = 135/200 (67.50%), Postives = 159/200 (79.50%), Query Frame = 3
Query:   84 ISFTGLNITSGNTDNKERGIFKETGKMSRKGLMEQDLSKLDVTKLHPLSPEVISRQATINIGTIGHVAHGKSTVVKAISGVQTVRFKNELERNITIKLGYANAKIYKCEDDRCPRPMCYKAYGSGKEDNPLCDVPGFENCRMKLLRHVSFVDCPGHDILMATMLNGAAIMDGALLLIAANESCPQPPTSEHLAAVEIMRL 683
            ++FTGL       + K +  F+E G     GL EQ L+  D +KL+PLS E+I+RQATINIGTIGHVAHGKSTVV+AISGVQTVRFK+ELERNITIKLGYANAKIYKC++  CP P CY+++ S KE +P C  PG    R KL+RHVSFVDCPGHDILM+TML+GAA+MD ALLLIA NESCPQP TSEHLAA+EIM+L
Sbjct:   49 VAFTGLEEDGETEEEKRKREFEEGG-----GLPEQPLNP-DFSKLNPLSAEIINRQATINIGTIGHVAHGKSTVVRAISGVQTVRFKDELERNITIKLGYANAKIYKCQEPTCPEPDCYRSFKSDKEISPKCQRPGCPG-RYKLVRHVSFVDCPGHDILMSTMLSGAAVMDAALLLIAGNESCPQPQTSEHLAAIEIMKL 241          
BLAST of FC920680 vs. ExPASy Swiss-Prot
Match: IF2G_CHICK (Eukaryotic translation initiation factor 2 subunit 3 OS=Gallus gallus GN=EIF2S3 PE=1 SV=1)

HSP 1 Score: 261.922 bits (668), Expect = 2.337e-69
Identity = 133/169 (78.70%), Postives = 143/169 (84.62%), Query Frame = 3
Query:  177 LMEQDLSKLDVTKLHPLSPEVISRQATINIGTIGHVAHGKSTVVKAISGVQTVRFKNELERNITIKLGYANAKIYKCEDDRCPRPMCYKAYGSGKEDNPLCDVPGFENCRMKLLRHVSFVDCPGHDILMATMLNGAAIMDGALLLIAANESCPQPPTSEHLAAVEIMRL 683
            L  QDL+ LDVTKL PLSPEVISRQATINIGTIGHVAHGKSTVVKAISGV TVRFKNELERNITIKLGYANAKIYK +D  C RP CY++ GS   D    D+PG +    KL+RHVSFVDCPGHDILMATMLNGAA+MD ALLLIA NESCPQP TSEHLAA+EIM+L
Sbjct:   15 LSRQDLATLDVTKLTPLSPEVISRQATINIGTIGHVAHGKSTVVKAISGVHTVRFKNELERNITIKLGYANAKIYKLDDPSCSRPECYRSCGSSTPDEFPTDIPGTKG-NFKLVRHVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNESCPQPQTSEHLAAIEIMKL 182          
BLAST of FC920680 vs. ExPASy Swiss-Prot
Match: IF2G_RAT (Eukaryotic translation initiation factor 2 subunit 3 OS=Rattus norvegicus GN=Eif2s3 PE=1 SV=2)

HSP 1 Score: 261.536 bits (667), Expect = 3.052e-69
Identity = 133/169 (78.70%), Postives = 143/169 (84.62%), Query Frame = 3
Query:  177 LMEQDLSKLDVTKLHPLSPEVISRQATINIGTIGHVAHGKSTVVKAISGVQTVRFKNELERNITIKLGYANAKIYKCEDDRCPRPMCYKAYGSGKEDNPLCDVPGFENCRMKLLRHVSFVDCPGHDILMATMLNGAAIMDGALLLIAANESCPQPPTSEHLAAVEIMRL 683
            L  QDL+ LDVTKL PLS EVISRQATINIGTIGHVAHGKSTVVKAISGV TVRFKNELERNITIKLGYANAKIYK +D  CPRP CY++ GS   D    D+PG +    KL+RHVSFVDCPGHDILMATMLNGAA+MD ALLLIA NESCPQP TSEHLAA+EIM+L
Sbjct:   15 LSRQDLATLDVTKLTPLSHEVISRQATINIGTIGHVAHGKSTVVKAISGVHTVRFKNELERNITIKLGYANAKIYKLDDPSCPRPECYRSCGSSTPDEFPTDIPGTKG-NFKLVRHVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNESCPQPQTSEHLAAIEIMKL 182          
BLAST of FC920680 vs. ExPASy Swiss-Prot
Match: IF2G_PONAB (Eukaryotic translation initiation factor 2 subunit 3 OS=Pongo abelii GN=EIF2S3 PE=2 SV=1)

HSP 1 Score: 261.536 bits (667), Expect = 3.052e-69
Identity = 133/169 (78.70%), Postives = 143/169 (84.62%), Query Frame = 3
Query:  177 LMEQDLSKLDVTKLHPLSPEVISRQATINIGTIGHVAHGKSTVVKAISGVQTVRFKNELERNITIKLGYANAKIYKCEDDRCPRPMCYKAYGSGKEDNPLCDVPGFENCRMKLLRHVSFVDCPGHDILMATMLNGAAIMDGALLLIAANESCPQPPTSEHLAAVEIMRL 683
            L  QDL+ LDVTKL PLS EVISRQATINIGTIGHVAHGKSTVVKAISGV TVRFKNELERNITIKLGYANAKIYK +D  CPRP CY++ GS   D    D+PG +    KL+RHVSFVDCPGHDILMATMLNGAA+MD ALLLIA NESCPQP TSEHLAA+EIM+L
Sbjct:   15 LSRQDLTTLDVTKLTPLSHEVISRQATINIGTIGHVAHGKSTVVKAISGVHTVRFKNELERNITIKLGYANAKIYKLDDPSCPRPECYRSCGSSTPDEFPTDIPGTKG-NFKLVRHVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNESCPQPQTSEHLAAIEIMKL 182          
BLAST of FC920680 vs. ExPASy Swiss-Prot
Match: IF2G_MOUSE (Eukaryotic translation initiation factor 2 subunit 3, X-linked OS=Mus musculus GN=Eif2s3x PE=1 SV=2)

HSP 1 Score: 261.536 bits (667), Expect = 3.052e-69
Identity = 133/169 (78.70%), Postives = 143/169 (84.62%), Query Frame = 3
Query:  177 LMEQDLSKLDVTKLHPLSPEVISRQATINIGTIGHVAHGKSTVVKAISGVQTVRFKNELERNITIKLGYANAKIYKCEDDRCPRPMCYKAYGSGKEDNPLCDVPGFENCRMKLLRHVSFVDCPGHDILMATMLNGAAIMDGALLLIAANESCPQPPTSEHLAAVEIMRL 683
            L  QDL+ LDVTKL PLS EVISRQATINIGTIGHVAHGKSTVVKAISGV TVRFKNELERNITIKLGYANAKIYK +D  CPRP CY++ GS   D    D+PG +    KL+RHVSFVDCPGHDILMATMLNGAA+MD ALLLIA NESCPQP TSEHLAA+EIM+L
Sbjct:   15 LSRQDLATLDVTKLTPLSHEVISRQATINIGTIGHVAHGKSTVVKAISGVHTVRFKNELERNITIKLGYANAKIYKLDDPSCPRPECYRSCGSSTPDEFPTDIPGTKG-NFKLVRHVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNESCPQPQTSEHLAAIEIMKL 182          
BLAST of FC920680 vs. ExPASy Swiss-Prot
Match: IF2G_HUMAN (Eukaryotic translation initiation factor 2 subunit 3 OS=Homo sapiens GN=EIF2S3 PE=1 SV=3)

HSP 1 Score: 261.536 bits (667), Expect = 3.052e-69
Identity = 133/169 (78.70%), Postives = 143/169 (84.62%), Query Frame = 3
Query:  177 LMEQDLSKLDVTKLHPLSPEVISRQATINIGTIGHVAHGKSTVVKAISGVQTVRFKNELERNITIKLGYANAKIYKCEDDRCPRPMCYKAYGSGKEDNPLCDVPGFENCRMKLLRHVSFVDCPGHDILMATMLNGAAIMDGALLLIAANESCPQPPTSEHLAAVEIMRL 683
            L  QDL+ LDVTKL PLS EVISRQATINIGTIGHVAHGKSTVVKAISGV TVRFKNELERNITIKLGYANAKIYK +D  CPRP CY++ GS   D    D+PG +    KL+RHVSFVDCPGHDILMATMLNGAA+MD ALLLIA NESCPQP TSEHLAA+EIM+L
Sbjct:   15 LSRQDLTTLDVTKLTPLSHEVISRQATINIGTIGHVAHGKSTVVKAISGVHTVRFKNELERNITIKLGYANAKIYKLDDPSCPRPECYRSCGSSTPDEFPTDIPGTKG-NFKLVRHVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNESCPQPQTSEHLAAIEIMKL 182          
BLAST of FC920680 vs. ExPASy Swiss-Prot
Match: IF2H_MOUSE (Eukaryotic translation initiation factor 2 subunit 3, Y-linked OS=Mus musculus GN=Eif2s3y PE=2 SV=2)

HSP 1 Score: 260.381 bits (664), Expect = 6.798e-69
Identity = 131/169 (77.51%), Postives = 143/169 (84.62%), Query Frame = 3
Query:  177 LMEQDLSKLDVTKLHPLSPEVISRQATINIGTIGHVAHGKSTVVKAISGVQTVRFKNELERNITIKLGYANAKIYKCEDDRCPRPMCYKAYGSGKEDNPLCDVPGFENCRMKLLRHVSFVDCPGHDILMATMLNGAAIMDGALLLIAANESCPQPPTSEHLAAVEIMRL 683
            L  QDL+ LDVTKL PLS E+ISRQATINIGTIGHVAHGKSTVVKAISGV TVRFKNELERNITIKLGYANAKIYK +D  CPRP CY++ GS   D    D+PG +    +L+RHVSFVDCPGHDILMATMLNGAA+MD ALLLIA NESCPQP TSEHLAA+EIM+L
Sbjct:   15 LSRQDLATLDVTKLTPLSREIISRQATINIGTIGHVAHGKSTVVKAISGVHTVRFKNELERNITIKLGYANAKIYKLDDSSCPRPECYRSCGSSTPDEFPSDIPGTKG-NFRLVRHVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNESCPQPQTSEHLAAIEIMKL 182          
BLAST of FC920680 vs. ExPASy Swiss-Prot
Match: IF2G_BOVIN (Eukaryotic translation initiation factor 2 subunit 3 OS=Bos taurus GN=EIF2S3 PE=2 SV=1)

HSP 1 Score: 259.996 bits (663), Expect = 8.879e-69
Identity = 132/169 (78.11%), Postives = 143/169 (84.62%), Query Frame = 3
Query:  177 LMEQDLSKLDVTKLHPLSPEVISRQATINIGTIGHVAHGKSTVVKAISGVQTVRFKNELERNITIKLGYANAKIYKCEDDRCPRPMCYKAYGSGKEDNPLCDVPGFENCRMKLLRHVSFVDCPGHDILMATMLNGAAIMDGALLLIAANESCPQPPTSEHLAAVEIMRL 683
            L  QDL+ LDV+KL PLS EVISRQATINIGTIGHVAHGKSTVVKAISGV TVRFKNELERNITIKLGYANAKIYK +D  CPRP CY++ GS   D    D+PG +    KL+RHVSFVDCPGHDILMATMLNGAA+MD ALLLIA NESCPQP TSEHLAA+EIM+L
Sbjct:   15 LSRQDLATLDVSKLTPLSHEVISRQATINIGTIGHVAHGKSTVVKAISGVHTVRFKNELERNITIKLGYANAKIYKLDDPSCPRPECYRSCGSSTPDEFPTDIPGTKG-NFKLVRHVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNESCPQPQTSEHLAAIEIMKL 182          
BLAST of FC920680 vs. ExPASy Swiss-Prot
Match: IF2G_SCHPO (Eukaryotic translation initiation factor 2 subunit gamma OS=Schizosaccharomyces pombe GN=tif213 PE=2 SV=1)

HSP 1 Score: 258.84 bits (660), Expect = 1.978e-68
Identity = 125/161 (77.64%), Postives = 141/161 (87.58%), Query Frame = 3
Query:  201 LDVTKLHPLSPEVISRQATINIGTIGHVAHGKSTVVKAISGVQTVRFKNELERNITIKLGYANAKIYKCEDDRCPRPMCYKAYGSGKEDNPLCDVPGFENCRMKLLRHVSFVDCPGHDILMATMLNGAAIMDGALLLIAANESCPQPPTSEHLAAVEIMRL 683
            LD+++L P+ P +ISRQATINIGTIGHVAHGKSTVVKAISGV TVRFKNELERNITIKLGYANAKIYKC ++ CPRP CY++Y S KED+P C++    N  M L+RHVSFVDCPGHDILMATMLNGAA+MD ALLLIA NESCPQP TSEHLAA+EIM+L
Sbjct:    5 LDISELSPIHPAIISRQATINIGTIGHVAHGKSTVVKAISGVHTVRFKNELERNITIKLGYANAKIYKCSNEECPRPGCYRSYSSNKEDHPPCEIC---NSPMNLVRHVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNESCPQPQTSEHLAAIEIMQL 162          
BLAST of FC920680 vs. ExPASy Swiss-Prot
Match: IF2GL_HUMAN (Eukaryotic translation initiation factor 2 subunit 3-like protein OS=Homo sapiens PE=1 SV=2)

HSP 1 Score: 258.84 bits (660), Expect = 1.978e-68
Identity = 131/169 (77.51%), Postives = 143/169 (84.62%), Query Frame = 3
Query:  177 LMEQDLSKLDVTKLHPLSPEVISRQATINIGTIGHVAHGKSTVVKAISGVQTVRFKNELERNITIKLGYANAKIYKCEDDRCPRPMCYKAYGSGKEDNPLCDVPGFENCRMKLLRHVSFVDCPGHDILMATMLNGAAIMDGALLLIAANESCPQPPTSEHLAAVEIMRL 683
            L  QDL+ LDVTKL PLS EVISRQATINIGTIGHVAHGKSTVVKAISGV TVRFKNELERNITIKLGYANAKIY+ +D  CPRP CY++ GS   D    D+PG +    +L+RHVSFVDCPGHDILMATMLNGAA+MD ALLLIA NESCPQP TSEHLAA+EIM+L
Sbjct:   15 LSRQDLTTLDVTKLTPLSHEVISRQATINIGTIGHVAHGKSTVVKAISGVHTVRFKNELERNITIKLGYANAKIYQLDDPSCPRPECYRSCGSSMPDEFPTDIPGTKG-NFRLVRHVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNESCPQPQTSEHLAAIEIMKL 182          
The following BLAST results are available for this feature:
BLAST of FC920680 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 57
Match NameE-valueIdentityDescription
IF2G_YEAST2.337e-6967.50Eukaryotic translation initiation factor 2 subunit... [more]
IF2G_CHICK2.337e-6978.70Eukaryotic translation initiation factor 2 subunit... [more]
IF2G_RAT3.052e-6978.70Eukaryotic translation initiation factor 2 subunit... [more]
IF2G_PONAB3.052e-6978.70Eukaryotic translation initiation factor 2 subunit... [more]
IF2G_MOUSE3.052e-6978.70Eukaryotic translation initiation factor 2 subunit... [more]
IF2G_HUMAN3.052e-6978.70Eukaryotic translation initiation factor 2 subunit... [more]
IF2H_MOUSE6.798e-6977.51Eukaryotic translation initiation factor 2 subunit... [more]
IF2G_BOVIN8.879e-6978.11Eukaryotic translation initiation factor 2 subunit... [more]
IF2G_SCHPO1.978e-6877.64Eukaryotic translation initiation factor 2 subunit... [more]
IF2GL_HUMAN1.978e-6877.51Eukaryotic translation initiation factor 2 subunit... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32011F07EF RVDevelop1 Citrus clementina cDNA clone C32011F07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920680 ID=FC920680|Name=FC920680|organism=Citrus clementina|type=EST|length=701bp
GCTCTCACAATCAATATAGCGGCAAACCTCAGTCAAATCTCGGTCTCGCA
GTCGTTCTCCGGCCGCAACTTGCTCTGCATTCAATCAGTTTTACGGGCTT
GAACATTACTAGTGGCAATACAGACAATAAGGAGAGGGGTATTTTCAAAG
AAACAGGCAAGATGTCACGGAAGGGTTTGATGGAACAGGACTTGAGTAAG
TTGGATGTAACTAAGTTGCATCCTCTTTCTCCTGAAGTCATTTCTCGCCA
GGCTACTATTAATATTGGAACTATCGGTCATGTGGCCCATGGCAAATCAA
CTGTTGTGAAGGCAATATCTGGTGTTCAGACTGTTCGTTTTAAGAATGAA
TTAGAGCGTAACATTACTATCAAGCTTGGATATGCAAATGCCAAGATATA
CAAATGTGAAGATGATCGTTGCCCACGACCAATGTGCTATAAGGCATATG
GAAGTGGGAAAGAAGATAATCCTCTGTGCGATGTGCCTGGTTTTGAGAAC
TGCAGGATGAAATTGCTTAGGCATGTCTCTTTTGTTGATTGCCCGGGTCA
TGATATTCTTATGGCTACAATGCTTAATGGAGCAGCAATTATGGATGGAG
CATTGCTTCTCATAGCAGCCAATGAAAGTTGCCCGCAACCACCAACATCG
GAGCACTTGGCAGCTGTTGAAATCATGCGTCTCCACATATAATATTCTTC
A
back to top