FC920683

Overview
NameFC920683
Unique NameFC920683
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length713
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10346 contig Ccv1_Contig10346:13..725. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920683 vs. ExPASy Swiss-Prot
Match: DR100_ARATH (DNA-damage-repair/toleration protein DRT100 OS=Arabidopsis thaliana GN=DRT100 PE=2 SV=2)

HSP 1 Score: 243.047 bits (619), Expect = 1.146e-63
Identity = 117/205 (57.07%), Postives = 150/205 (73.17%), Query Frame = 1
Query:  100 AQLLLIFLAXXXXXXNCCPPSERAALLAFKAALHEPYLGIFNSWTGN-DCCHNWYGVSCDQETHRVADINLRGESEDPIFQRAHRTGYMTGYISPAVCKLTRLSSFTLADWKGITGEIPRCISSIPFLRILDLIGNKLSGDIPPDIGRLHRLAVLNIADNNISGAIPPSIANLSSLMHLDLRNNRISGPIPGSVGRLRMMSRALL 711
            + LL +          CC P ++ AL AFK++L EP LGIFN+W+ N DCC  WYG+SCD ++ RV DI+LRGESED IFQ+A R+GYM+G I PAVC LT L+S  LADWKGITGEIP CI+S+  LRILDL GNK++G+IP +IG+L +LAVLN+A+N +SG IP S+ +L  L HL+L  N I+G IP   G L+M+SR LL
Sbjct:   10 SSLLAVVFISVISVVRCCSPKDQTALNAFKSSLSEPNLGIFNTWSENTDCCKEWYGISCDPDSGRVTDISLRGESEDAIFQKAGRSGYMSGSIDPAVCDLTALTSLVLADWKGITGEIPPCITSLASLRILDLAGNKITGEIPAEIGKLSKLAVLNLAENQMSGEIPASLTSLIELKHLELTENGITGVIPADFGSLKMLSRVLL 214          
BLAST of FC920683 vs. ExPASy Swiss-Prot
Match: PGIP_VITVI (Polygalacturonase inhibitor OS=Vitis vinifera GN=pgip PE=1 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 3.731e-22
Identity = 66/198 (33.33%), Postives = 96/198 (48.48%), Query Frame = 1
Query:   97 TAQLLLIFLAXXXXXX--NCCPPSERAALLAFKAALHEPYLGIFNSWTGNDCCHNWYGVSCDQETHRVADINLRGESEDPIFQRAHRTGYMTGYISPAVCKLTRLSSFTLADWKGITGEIPRCISSIPFLRILDLIGNKLSGDIPPDIGRLHRLAVLNIADNNISGAIPPSIANLSSLMHLDLRNNRISGPIPGSVGR 684
            ++ LLL+ LA          C P ++  LL  K AL  PY  I  SW  N  C  WY V CD  THR+  + +              +G ++G I  AV  L  L +        +TG+IP  I+ +  L+++ L    LSG +P     L  L  L+++ NN+SG IP S++ L +L  L L  N ++GPIP S G+
Sbjct:   10 SSSLLLVLLATRPCPSLSERCNPKDKKVLLQIKKALDNPY--ILASWNPNTDCCGWYCVECDLTTHRINSLTIF-------------SGQLSGQIPDAVGDLPFLETLIFRKLSNLTGQIPPAIAKLKHLKMVRLSWTNLSGPVPAFFSELKNLTYLDLSFNNLSGPIPGSLSLLPNLGALHLDRNHLTGPIPDSFGK 192          
BLAST of FC920683 vs. ExPASy Swiss-Prot
Match: PGIP1_ORYSJ (Polygalacturonase inhibitor 1 OS=Oryza sativa subsp. japonica GN=FOR1 PE=2 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 5.388e-21
Identity = 65/202 (32.18%), Postives = 104/202 (51.49%), Query Frame = 1
Query:   73 MGGCVSFYTAQLLLIFLAXXXXXXNCCPPSERAALLAFKAALHEPYLGIFNSWTGNDCCHNWYGVSCDQETHRVADINLRGESEDPIFQRAHRTGYMTGYISPAVCKLTRLSSFTLADWKGITGEIPRCISSIPFLRILDLIGNKLSGDIPPDIGRLHRLAVLNIADNNISGAIPPSIANLSSLMHLDLRNNRISGPIPGSV 678
            M    SF  A LL + +A        CPPS++ AL+  K +L  P      S    DCC  W  V CD E  RV ++ + G ++            + G I  AV  LT L S +L    G++G IP C++++  L+ L +    +SG IP  + R+  L  ++++ N+++G IP S ++L +L  LDLR+N+++G IP  +
Sbjct:    1 MASTASFMLAVLLAVAVAAAPARAVRCPPSDKQALMRVKQSLGNPATLSTWSLASADCCE-WDHVRCD-EAGRVNNVFIDGAND------------VRGQIPSAVAGLTALMSLSLFRLPGLSGPIPACLTALSNLQFLTISHTNVSGVIPDSLARIRSLDSVDLSHNSLTGPIPNSFSDLPNLRSLDLRSNKLTGCIPAGL 188          
BLAST of FC920683 vs. ExPASy Swiss-Prot
Match: Y1684_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g06840 OS=Arabidopsis thaliana GN=At1g06840 PE=1 SV=2)

HSP 1 Score: 100.908 bits (250), Expect = 7.036e-21
Identity = 67/185 (36.22%), Postives = 96/185 (51.89%), Query Frame = 1
Query:  157 PSERAALLAFKAALHEPYLGIFNSWTGNDCCHNWYGVSCDQETHRVADINLRGESEDPIFQRAHRTGYMTGYISPAVCKLTRLSSFTLADWKGITGEIPRCISSIPFLRILDLIGNKLSGDIPPDIGRLHRLAVLNIADNNISGAIPPSIANLSSLMHLDLRNNRISGPIPGSVGRLRMMSRALL 711
            P E  AL   K +L++P   + N   G+ C  NW GV C   T    D      SE  +F        ++G +SP + +L+RL+  +   W  ITG IP+ I +I  L +L L GN L+G++P ++G L  L  + I +N ISG +P S ANL+   H  + NN ISG IP  +G L  +   LL
Sbjct:   35 PVEVRALRVIKESLNDPVHRLRNWKHGDPCNSNWTGVVCFNST---LDDGYLHVSELQLFSMN-----LSGNLSPELGRLSRLTILSFM-WNKITGSIPKEIGNIKSLELLLLNGNLLNGNLPEELGFLPNLDRIQIDENRISGPLPKSFANLNKTKHFHMNNNSISGQIPPELGSLPSIVHILL 210          
BLAST of FC920683 vs. ExPASy Swiss-Prot
Match: RPK2_ARATH (LRR receptor-like serine/threonine-protein kinase RPK2 OS=Arabidopsis thaliana GN=RPK2 PE=1 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 2.264e-19
Identity = 67/219 (30.59%), Postives = 102/219 (46.58%), Query Frame = 1
Query:  109 LLIFLAXXXXXXNCCPPSERAALLAFKAALHEPYLGIFNSWT--GNDCCHNWYGVSCDQETHRVADINLRGESEDPIFQRAHRTG---------------------YMTGYISPAVCKLTRLSSFTLADWKGITGEIPRCISSIPFLRILDLIGNKLSGDIPPDIGRLHRLAVLNIADNNISGAIPPSIANLSSLMHLDLRNNRISGPIPGSVGRLRMM 696
            LL F +           S+++ LL FK  + +P   I  SW     D C +W+GVSCD  + RV  +N+ G     I +     G                      + G +   +  LT L   +L  +   +GEIP  I  +  L +LDL GN ++G +P     L  L V+N+  N +SG IP S+ NL+ L  L+L  N+++G +PG VGR R++
Sbjct:   28 LLCFASCLAGKITVLADSDKSVLLRFKKTVSDPG-SILASWVEESEDYC-SWFGVSCDSSS-RVMALNISGSGSSEISRNRFTCGDIGKFPLYGFGVRRDCTGNHGALAGNLPSVIMSLTGLRVLSLP-FNSFSGEIPVGIWGMEKLEVLDLEGNLMTGSLPDQFTGLRNLRVMNLGFNRVSGEIPNSLQNLTKLEILNLGGNKLNGTVPGFVGRFRVL 242          

HSP 2 Score: 68.9366 bits (167), Expect = 2.963e-11
Identity = 39/102 (38.24%), Postives = 57/102 (55.88%), Query Frame = 1
Query:  367 GYISPAVCKLTRLSSFTLADWKGITGEIPRCISS-IPFLRILDLIGNKLSGDIPPDIGRLHRLAVLNIADNNISGAIPPSIANLSSLMHLDLRNNRISGPIP 669
            G I  ++  L  L +  L+ W  + G+IP  +   +  L  L +  N L+G IP   G+LH L VL+++ N++SG IP    NL +L  L L NN +SGPIP
Sbjct:  624 GPIPTSLGDLASLVALNLS-WNQLQGQIPGSLGKKMAALTYLSIANNNLTGQIPQSFGQLHSLDVLDLSSNHLSGGIPHDFVNLKNLTVLLLNNNNLSGPIP 724          
BLAST of FC920683 vs. ExPASy Swiss-Prot
Match: PGIP1_ARATH (Polygalacturonase inhibitor 1 OS=Arabidopsis thaliana GN=PGIP1 PE=2 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 2.503e-18
Identity = 67/215 (31.16%), Postives = 101/215 (46.98%), Query Frame = 1
Query:   97 TAQLLLIFL---AXXXXXXNCCPPSERAALLAFKAALHEPYLGIFNSWTGNDCCHNWYGVSCDQET--HRVADINL-RGESEDPIFQRAHRTGYM-----------TGYISPAVCKLTRLSSFTLADWKGITGEIPRCISSIPFLRILDLIGNKLSGDIPPDIGRLHRLAVLNIADNNISGAIPPSIANL-SSLMHLDLRNNRISGPIPGSVGRL 687
            TA L L+FL          + C  +++  LL  K +L+ PY     SW     C +WY + C   T  HRV  + +  G+    I        Y+           TG I P + KL  L    L+ W  +TG IP  IS +  L  L+L  N LSG IP  +  L ++  L ++ N ++G+IP S  +   ++  L L +N++SGPIP S+G +
Sbjct:    4 TATLCLLFLFTFLTTCLSKDLCNQNDKNTLLKIKKSLNNPYH--LASWDPQTDCCSWYCLECGDATVNHRVTALTIFSGQISGQIPAEVGDLPYLETLVFRKLSNLTGTIQPTIAKLKNLRMLRLS-WTNLTGPIPDFISQLKNLEFLELSFNDLSGSIPSSLSTLPKILALELSRNKLTGSIPESFGSFPGTVPDLRLSHNQLSGPIPKSLGNI 215          
BLAST of FC920683 vs. ExPASy Swiss-Prot
Match: EFR_ARATH (LRR receptor-like serine/threonine-protein kinase EFR OS=Arabidopsis thaliana GN=EFR PE=1 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 3.269e-18
Identity = 62/203 (30.54%), Postives = 94/203 (46.31%), Query Frame = 1
Query:  160 SERAALLAFKAALHEPYLG-IFNSWTGNDCCHNWYGVSCDQETHRVADINLRGESEDPIFQRAHRTGYMTGYISPAVCKLTRLSSFTLAD-----------------------WKGITGEIPRCISSIPFLRILDLIGNKLSGDIPPDIGRLHRLAVLNIADNNISGAIPPSIANLSSLMHLDLRNNRISGPIPGSVGRLRMM 696
            ++  ALL FK+ + E     +  SW  +    NW GV+C +   RV  +NL G               +TG ISP++  L+ L    LAD                       +  + G IP  +S+   L  +DL  N L   +P ++G L +LA+L+++ NN++G  P S+ NL+SL  LD   N++ G IP  V RL  M
Sbjct:   30 TDMQALLEFKSQVSENNKREVLASWNHSSPFCNWIGVTCGRRRERVISLNLGGFK-------------LTGVISPSIGNLSFLRLLNLADNSFGSTIPQKVGRLFRLQYLNMSYNLLEGRIPSSLSNCSRLSTVDLSSNHLGHGVPSELGSLSKLAILDLSKNNLTGNFPASLGNLTSLQKLDFAYNQMRGEIPDEVARLTQM 219          
BLAST of FC920683 vs. ExPASy Swiss-Prot
Match: PGIP2_ARATH (Polygalacturonase inhibitor 2 OS=Arabidopsis thaliana GN=PGIP2 PE=2 SV=2)

HSP 1 Score: 91.6633 bits (226), Expect = 4.269e-18
Identity = 64/207 (30.92%), Postives = 95/207 (45.89%), Query Frame = 1
Query:  106 LLLIFLAXXXXXXNCCPPSERAALLAFKAALHEPYLGIFNSWTGNDCCHNWYGVSCDQET--HRVADINLR-GESEDPIFQRAHRTGYMT-----------GYISPAVCKLTRLSSFTLADWKGITGEIPRCISSIPFLRILDLIGNKLSGDIPPDIGRLHRLAVLNIADNNISGAIPPSIANLS-SLMHLDLRNNRISGPIPGSVG 681
            LL   L       + C   ++  LL  K +L+ PY     SW     C +WY + C   T  HRV  + ++ GE    I        Y+T           G+I P + KL  L+   L+ W  +TG +P  +S +  L  +DL  N LSG IP  +  L +L  L ++ N ++G IP S    S  +  L L +N++SG IP S+G
Sbjct:   10 LLSTLLLTTSLAKDLCHKDDKTTLLKIKKSLNNPYH--LASWDPKTDCCSWYCLECGDATVNHRVTSLIIQDGEISGQIPPEVGDLPYLTSLIFRKLTNLTGHIQPTIAKLKNLTFLRLS-WTNLTGPVPEFLSQLKNLEYIDLSFNDLSGSIPSSLSSLRKLEYLELSRNKLTGPIPESFGTFSGKVPSLFLSHNQLSGTIPKSLG 213          
BLAST of FC920683 vs. ExPASy Swiss-Prot
Match: PGIP_PYRCO (Polygalacturonase inhibitor OS=Pyrus communis GN=PGIP PE=1 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 7.281e-18
Identity = 55/178 (30.90%), Postives = 88/178 (49.44%), Query Frame = 1
Query:  151 CPPSERAALLAFKAALHEPYLGIFNSWTGNDCCHNWYGVSCDQETHRVADINLRGESEDPIFQRAHRTGYMTGYISPAVCKLTRLSSFTLADWKGITGEIPRCISSIPFLRILDLIGNKLSGDIPPDIGRLHRLAVLNIADNNISGAIPPSIANLSSLMHLDLRNNRISGPIPGSVGR 684
            C P ++  LL  K A  +PY  +  SW  +  C +WY V+CD  T+R+  + +               G ++G I   V  L  L +        +TG I   I+ +  L+ L L    LSG +P  + +L  L  L+++ NN++GAIP S++ L +L  L L  N+++G IP S G+
Sbjct:   27 CNPDDKKVLLQIKKAFGDPY--VLASWKSDTDCCDWYCVTCDSTTNRINSLTIFA-------------GQVSGQIPALVGDLPYLETLEFHKQPNLTGPIQPAIAKLKGLKSLRLSWTNLSGSVPDFLSQLKNLTFLDLSFNNLTGAIPSSLSELPNLGALRLDRNKLTGHIPISFGQ 189          
BLAST of FC920683 vs. ExPASy Swiss-Prot
Match: Y4361_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At4g36180 OS=Arabidopsis thaliana GN=At4g36180 PE=1 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 1.242e-17
Identity = 65/192 (33.85%), Postives = 100/192 (52.08%), Query Frame = 1
Query:  160 SERAALLAFKAALHEPYLGIFNSWTGNDCCH--NWYGVSCDQETHRVADINL-----RGESEDPIF------QRAHRTGYMTGYISPAVCKLTRLSSFTLADWKGITGEIPRCISSIPFLRILDLIGNKLSGDIPPDIGRLHRLAVLNIADNNISGAIPPSIANLSSLMHLDLRNNRISGPIPGSVGRLRMM 696
            +E  AL AFK  LH+P LG   SW  +      +W GV C    HRV +I L      G   D I       + + R+    G I  ++   TRL S  L  +  ++G++P  + ++  L + ++ GN+LSG+IP  +G    L  L+I+ N  SG IP  +ANL+ L  L+L  N+++G IP S+G L+ +
Sbjct:   27 AEIDALTAFKLNLHDP-LGALTSWDPSTPAAPCDWRGVGCTN--HRVTEIRLPRLQLSGRISDRISGLRMLRKLSLRSNSFNGTIPTSLAYCTRLLSVFL-QYNSLSGKLPPAMRNLTSLEVFNVAGNRLSGEIP--VGLPSSLQFLDISSNTFSGQIPSGLANLTQLQLLNLSYNQLTGEIPASLGNLQSL 212          

HSP 2 Score: 80.1073 bits (196), Expect = 1.285e-14
Identity = 46/103 (44.66%), Postives = 63/103 (61.17%), Query Frame = 1
Query:  394 LTRLSSFTLADWKGITGEIPRCISSIPFLRILDLIGNKLSGDIPPDIGRLHRLAVLNIADNNISGAIPPSIANLSSLMHLDLRNNRISGPIPGSVGRLRMMSR 702
            L  L S +L+D   I+G IP  I +   L +L+L  N+L G IP D+ RL RL VL++  NN+SG IPP I+  SSL  L L +N +SG IPGS   L  +++
Sbjct:  571 LRLLVSLSLSD-NHISGSIPPEIGNCSALEVLELRSNRLMGHIPADLSRLPRLKVLDLGQNNLSGEIPPEISQSSSLNSLSLDHNHLSGVIPGSFSGLSNLTK 672          

HSP 3 Score: 75.485 bits (184), Expect = 3.166e-13
Identity = 38/83 (45.78%), Postives = 54/83 (65.06%), Query Frame = 1
Query:  439 TGEIPRCISSIPFLRILDLIGNKLSGDIPPDIGRLHRLAVLNIADNNISGAIPPSIANLSSLMHLDLRNNRISGPIPGSVGRL 687
            +G +P   SS+  LR ++L  N  SG+IP   G L  L  L+++DN+ISG+IPP I N S+L  L+LR+NR+ G IP  + RL
Sbjct:  537 SGVVPEGFSSLVSLRYVNLSSNSFSGEIPQTFGFLRLLVSLSLSDNHISGSIPPEIGNCSALEVLELRSNRLMGHIPADLSRL 619          

HSP 4 Score: 72.7886 bits (177), Expect = 2.052e-12
Identity = 40/107 (37.38%), Postives = 64/107 (59.81%), Query Frame = 1
Query:  358 YMTGYISPAVCKLTRLSSFTLADWKGITGEIPRCISSIPFLRILDLIGNKLSGDIPPDIGRLHRLAVLNIADNNISGAIPPSIANLSSLMHLDLRNNRISGPIPGSV 678
            +++G I P +   + L    L   + + G IP  +S +P L++LDL  N LSG+IPP+I +   L  L++  N++SG IP S + LS+L  +DL  N ++G IP S+
Sbjct:  583 HISGSIPPEIGNCSALEVLELRSNR-LMGHIPADLSRLPRLKVLDLGQNNLSGEIPPEISQSSSLNSLSLDHNHLSGVIPGSFSGLSNLTKMDLSVNNLTGEIPASL 688          

HSP 5 Score: 70.8626 bits (172), Expect = 7.798e-12
Identity = 36/87 (41.38%), Postives = 53/87 (60.92%), Query Frame = 1
Query:  436 ITGEIPRCISSIPFLRILDLIGNKLSGDIPPDIGRLHRLAVLNIADNNISGAIPPSIANLSSLMHLDLRNNRISGPIPGSVGRLRMM 696
            I+G  P  +++I  L+ LD+ GN  SG+IPPDIG L RL  L +A+N+++G IP  I    SL  LD   N + G IP  +G ++ +
Sbjct:  320 ISGRFPLWLTNILSLKNLDVSGNLFSGEIPPDIGNLKRLEELKLANNSLTGEIPVEIKQCGSLDVLDFEGNSLKGQIPEFLGYMKAL 406          

HSP 6 Score: 69.3218 bits (168), Expect = 2.269e-11
Identity = 36/111 (32.43%), Postives = 64/111 (57.66%), Query Frame = 1
Query:  364 TGYISPAVCKLTRLSSFTLADWKGITGEIPRCISSIPFLRILDLIGNKLSGDIPPDIGRLHRLAVLNIADNNISGAIPPSIANLSSLMHLDLRNNRISGPIPGSVGRLRMM 696
            +G +  ++  L+ LS   L+   G +GEIP  + ++  L  LDL    +SG++P ++  L  + V+ +  NN SG +P   ++L SL +++L +N  SG IP + G LR++
Sbjct:  465 SGAVPVSISNLSNLSFLNLSG-NGFSGEIPASVGNLFKLTALDLSKQNMSGEVPVELSGLPNVQVIALQGNNFSGVVPEGFSSLVSLRYVNLSSNSFSGEIPQTFGFLRLL 574          

HSP 7 Score: 68.9366 bits (167), Expect = 2.963e-11
Identity = 46/136 (33.82%), Postives = 63/136 (46.32%), Query Frame = 1
Query:  364 TGYISPAVCKLTRLSSFTLADWKGITGEIPRCISSIPFLRILDLIGNKLSGDIPPDIGRLHRLAVL------------------------NIADNNISGAIPPSIANLSSLMHLDLRNNRISGPIPGSVGRLRMMS 699
            +G I P +  L RL    LA+   +TGEIP  I     L +LD  GN L G IP  +G +  L VL                        N+ +NN++G+ P  +  L+SL  LDL  NR SG +P S+  L  +S
Sbjct:  345 SGEIPPDIGNLKRLEELKLAN-NSLTGEIPVEIKQCGSLDVLDFEGNSLKGQIPEFLGYMKALKVLSLGRNSFSGYVPSSMVNLQQLERLNLGENNLNGSFPVELMALTSLSELDLSGNRFSGAVPVSISNLSNLS 479          

HSP 8 Score: 68.1662 bits (165), Expect = 5.054e-11
Identity = 36/102 (35.29%), Postives = 54/102 (52.94%), Query Frame = 1
Query:  364 TGYISPAVCKLTRLSSFTLADWKGITGEIPRCISSIPFLRILDLIGNKLSGDIPPDIGRLHRLAVLNIADNNISGAIPPSIANLSSLMHLDLRNNRISGPIP 669
            +GY+  ++  L +L    L +   + G  P  + ++  L  LDL GN+ SG +P  I  L  L+ LN++ N  SG IP S+ NL  L  LDL    +SG +P
Sbjct:  417 SGYVPSSMVNLQQLERLNLGE-NNLNGSFPVELMALTSLSELDLSGNRFSGAVPVSISNLSNLSFLNLSGNGFSGEIPASVGNLFKLTALDLSKQNMSGEVP 517          
The following BLAST results are available for this feature:
BLAST of FC920683 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 80
Match NameE-valueIdentityDescription
DR100_ARATH1.146e-6357.07DNA-damage-repair/toleration protein DRT100 OS=Ara... [more]
PGIP_VITVI3.731e-2233.33Polygalacturonase inhibitor OS=Vitis vinifera GN=p... [more]
PGIP1_ORYSJ5.388e-2132.18Polygalacturonase inhibitor 1 OS=Oryza sativa subs... [more]
Y1684_ARATH7.036e-2136.22Probable LRR receptor-like serine/threonine-protei... [more]
RPK2_ARATH2.264e-1930.59LRR receptor-like serine/threonine-protein kinase ... [more]
PGIP1_ARATH2.503e-1831.16Polygalacturonase inhibitor 1 OS=Arabidopsis thali... [more]
EFR_ARATH3.269e-1830.54LRR receptor-like serine/threonine-protein kinase ... [more]
PGIP2_ARATH4.269e-1830.92Polygalacturonase inhibitor 2 OS=Arabidopsis thali... [more]
PGIP_PYRCO7.281e-1830.90Polygalacturonase inhibitor OS=Pyrus communis GN=P... [more]
Y4361_ARATH1.242e-1733.85Probable LRR receptor-like serine/threonine-protei... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32011G01EF RVDevelop1 Citrus clementina cDNA clone C32011G01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920683 ID=FC920683|Name=FC920683|organism=Citrus clementina|type=EST|length=713bp
GCGTAAACTCAATCCACTTCTCTTCCCAACGTAAACCCAAAACTCATCGT
TTCGGATCAAGCAAAAACCAACATGGGTGGCTGTGTCTCGTTTTACACTG
CGCAGCTTCTTCTAATCTTCCTCGCCGTTAGTTCTTCCGTCGTTAATTGC
TGCCCGCCGTCAGAGCGGGCAGCACTCTTAGCCTTCAAAGCTGCCCTCCA
CGAGCCTTACTTGGGCATCTTCAACTCCTGGACGGGCAACGACTGTTGCC
ACAACTGGTACGGTGTTAGCTGTGACCAGGAAACTCACCGGGTCGCTGAC
ATTAACCTACGTGGCGAGTCTGAGGATCCGATATTCCAGCGGGCCCACCG
AACCGGGTACATGACCGGGTATATCTCACCCGCTGTGTGTAAACTCACGC
GTCTCTCCAGTTTCACGCTCGCCGACTGGAAAGGCATCACCGGGGAAATC
CCACGTTGCATTTCTTCAATTCCTTTTCTCCGCATTCTTGATTTAATCGG
AAATAAGTTATCGGGCGACATTCCCCCAGATATCGGCCGGCTTCACAGAC
TCGCTGTCTTAAATATCGCCGATAACAACATATCGGGTGCGATTCCCCCT
TCCATTGCTAATCTTTCCAGCTTGATGCATCTTGACTTGCGTAACAACAG
AATTTCGGGCCCGATTCCGGGAAGTGTCGGGCGACTCCGAATGATGAGCC
GGGCTTTGCTGTC
back to top