FC920684

Overview
NameFC920684
Unique NameFC920684
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length706
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig8083 contig Ccv1_Contig8083:63..768. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920684 vs. ExPASy Swiss-Prot
Match: ACCH1_ARATH (1-aminocyclopropane-1-carboxylate oxidase homolog 1 OS=Arabidopsis thaliana GN=At1g06620 PE=2 SV=1)

HSP 1 Score: 148.673 bits (374), Expect = 2.907e-35
Identity = 84/222 (37.84%), Postives = 117/222 (52.70%), Query Frame = 3
Query:   42 DRAKEVKRFDEPXXXXXXXXXXXXTAIPRFFIHPPATLADLRPKSKTRPVSDVVPTIDLSGVDSDDL-RPTIVEKIACASRELGFFQVVNHGIGVEVLERMVRAIKGFHEQPPEIKAPVYRRENAKGVSYISNIDLFHSKAASWRDTLQIRLGLTEPELEEVPEICRKEAVEWNHHVKQXXXXXXXXXXXXXXXKTDRLKEKTFLEGRMMVGHYYPXLSQPD 704
            DR+  +K FDE             T IP  F  PPATL   +P S +      +PTIDL G  +D + R ++VEKI  A+ + GFFQV+NHGI ++VLE+M+  I+ FHEQ  E+K   Y R+ A  + Y SN DLF S AA+WRDTL        P  E++P  C +  +E++  V +                T+ LK+       +++GHYYP   QPD
Sbjct:   12 DRSTLLKAFDETKTGVKGLIDAGITEIPSIFRAPPATLTSPKPPSSS---DFSIPTIDLKGGGTDSITRRSLVEKIGDAAEKWGFFQVINHGIPMDVLEKMIDGIREFHEQDTEVKKGFYSRDPASKMVYSSNFDLFSSPAANWRDTLGCYTAPDPPRPEDLPATCGEMMIEYSKEVMKLGKLLFELLSEALGLNTNHLKDMDCTNSLLLLGHYYPPCPQPD 230          
BLAST of FC920684 vs. ExPASy Swiss-Prot
Match: ACCH2_ARATH (1-aminocyclopropane-1-carboxylate oxidase homolog 2 OS=Arabidopsis thaliana GN=At1g06640 PE=2 SV=1)

HSP 1 Score: 147.902 bits (372), Expect = 4.958e-35
Identity = 80/231 (34.63%), Postives = 119/231 (51.52%), Query Frame = 3
Query:   18 TTMSLESYDRAKEVKRFDEPXXXXXXXXXXXXTAIPRFFIHPPATLADLRPKSKTRPVSDVVPTIDLSGVDSDDL--RPTIVEKIACASRELGFFQVVNHGIGVEVLERMVRAIKGFHEQPPEIKAPVYRRENAKGVSYISNIDLFHSKAASWRDTLQIRLGLTEPELEEVPEICRKEAVEWNHHVKQXXXXXXXXXXXXXXXKTDRLKEKTFLEGRMMVGHYYPXLSQPD 704
            +T    S+DRA E+K FDE             + IPR F H    LA+ +P          +PTIDL G D  D       +E I  A+ + GFFQV+NHG+ +E+LE+M   ++ FHEQPPE++  +Y R+  +   Y+SN DL+ + AA+WRDT    +    PE +++PEICR   +E++  V                   + LK+   L+G  M+ HY+P   +PD
Sbjct:    3 STKIAPSFDRASELKAFDETKTGVKGLVDSGISKIPRIFHHSSVELANPKPLPSDLLHLKTIPTIDLGGRDFQDAIKHKNAIEGIKEAAAKWGFFQVINHGVSLELLEKMKDGVRDFHEQPPEVRKDLYSRDFGRKFIYLSNFDLYTAAAANWRDTFYCYMAPDPPEPQDLPEICRDVMMEYSKQVMILGEFLFELLSEALGLNPNHLKDMECLKGLRMLCHYFPPCPEPD 233          
BLAST of FC920684 vs. ExPASy Swiss-Prot
Match: GSL_ARATH (Probable 2-oxoacid dependent dioxygenase OS=Arabidopsis thaliana GN=GSL-OH PE=2 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 6.476e-35
Identity = 77/225 (34.22%), Postives = 123/225 (54.67%), Query Frame = 3
Query:   33 ESYDRAKEVKRFDEPXXXXXXXXXXXXTAIPRFFIHPPATLADLRPKSKTRPVSDVVPTIDLSGV-DSDDLRPTIVEKIACASRELGFFQVVNHGIGVEVLERMVRAIKGFHEQPPEIKAPVYRRENAKGVSYISNIDLFHSKAASWRDTLQIRLGLTEPELEEVPEICRKEAVEWNHHVKQXXXXXXXXXXXXXXXKTDRLKEKTFLEGRMMVGHYYPXLSQPD 704
            E+YDRA E+K FDE             T +PR F +P   +A+ +P S       ++PTIDL GV +S  +R ++V K+  A  + GFFQ +NHG+ ++V+E+M+  I+ FH+Q PE++   Y R+  K + Y SN DL+ S AASWRDTL   +    P+ +++PE+C +  +E++  V +                 + LKE    +G  M+ H +P   +P+
Sbjct:    3 ENYDRASELKAFDEMKIGVKGLVDAGVTKVPRIFHNPHVNVANPKPTSTVV----MIPTIDLGGVFESTVVRESVVAKVKDAMEKFGFFQAINHGVPLDVMEKMINGIRRFHDQDPEVRKMFYTRDKTKKLKYHSNADLYESPAASWRDTLSCVMAPDVPKAQDLPEVCGEIMLEYSKEVMKLAELMFEILSEALGLSPNHLKEMDCAKGLWMLCHCFPPCPEPN 223          
BLAST of FC920684 vs. ExPASy Swiss-Prot
Match: ACCH3_ARATH (1-aminocyclopropane-1-carboxylate oxidase homolog 4 OS=Arabidopsis thaliana GN=At1g06650 PE=2 SV=1)

HSP 1 Score: 147.132 bits (370), Expect = 8.458e-35
Identity = 76/224 (33.93%), Postives = 117/224 (52.23%), Query Frame = 3
Query:   39 YDRAKEVKRFDEPXXXXXXXXXXXXTAIPRFFIHPPATLADLRPKSKTRPVSDVVPTIDLSGVDSDDL--RPTIVEKIACASRELGFFQVVNHGIGVEVLERMVRAIKGFHEQPPEIKAPVYRRENAKGVSYISNIDLFHSKAASWRDTLQIRLGLTEPELEEVPEICRKEAVEWNHHVKQXXXXXXXXXXXXXXXKTDRLKEKTFLEGRMMVGHYYPXLSQPD 704
            +DRA E+K FDE             + +PR F HP   L+  +P          +PTIDL G D  D   R   +E+I  A+ + GFFQV+NHG+ +E+LE+M + ++ FHEQ  E++   Y R+ ++   Y+SN DLF S AA+WRDT    +    P+ +++PEICR   +E++  V                 + + L +    +G +M+ HYYP   +PD
Sbjct:   10 FDRASELKAFDETKTGVKGLVDSGVSQVPRIFHHPTVKLSTPKPLPSDLLHLKTIPTIDLGGRDFQDAIKRNNAIEEIKEAAAKWGFFQVINHGVSLELLEKMKKGVRDFHEQSQEVRKEFYSRDFSRRFLYLSNFDLFSSPAANWRDTFSCTMAPDTPKPQDLPEICRDIMMEYSKQVMNLGKFLFELLSEALGLEPNHLNDMDCSKGLLMLSHYYPPCPEPD 233          
BLAST of FC920684 vs. ExPASy Swiss-Prot
Match: DV4H_CATRO (Deacetoxyvindoline 4-hydroxylase OS=Catharanthus roseus GN=D4H PE=1 SV=2)

HSP 1 Score: 137.502 bits (345), Expect = 6.701e-32
Identity = 82/233 (35.19%), Postives = 127/233 (54.51%), Query Frame = 3
Query:   15 ATTMSLESYDRAKEVKRFDEPXXXXXXXXXXXXTAIPRFFIHPPATLADLRPKSKTRPVSDV-VPTIDLSGVDSD-DLRPTIVEKIACASRELGFFQVVNHGIGVEVLERMVRAIKGFHEQPPEIKAPVYRREN-AKGVSYISNIDLFHSKAASWRDTLQIRLGLTEPELEEVPEICRKEAVEWNHHVKQXXXXXXXXXXXXXXXKTDRLKEKTFLEGRMMVGHYYPXLSQPD 704
            A T+S E  +  +E+K FDE             T IPR FI  P  L  +   S  R  SD+ +P I+L+G+ S+ ++R  IVEKI  AS + GFFQ+VNHGI  +V+++MV  ++ FHEQ  +IK   Y R+   K   Y SN  L    A +WRDT++  +   +P+ +E P++CR   ++++++V+                K + L+E    EG +++GHYYP   QP+
Sbjct:   33 AATLSEE--ESLRELKAFDETKAGVKGIVDTGITKIPRIFIDQPKNLDRI---SVCRGKSDIKIPVINLNGLSSNSEIRREIVEKIGEASEKYGFFQIVNHGIPQDVMDKMVDGVRKFHEQDDQIKRQYYSRDRFNKNFLYSSNYVLIPGIACNWRDTMECIMNSNQPDPQEFPDVCRDILMKYSNYVRNLGLILFELLSEALGLKPNHLEEMDCAEGLILLGHYYPACPQPE 260          
BLAST of FC920684 vs. ExPASy Swiss-Prot
Match: ACCH3_SOLLC (1-aminocyclopropane-1-carboxylate oxidase homolog OS=Solanum lycopersicum GN=ACO3 PE=2 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 5.310e-29
Identity = 77/227 (33.92%), Postives = 112/227 (49.34%), Query Frame = 3
Query:   33 ESYDRAKEVKRFDEPXXXXXXXXXXXXTAIPRFFIHPPATLADLRPKSKTRPVSDVVPTIDLSGVDSDDLR-PTIVEKIACASRELGFFQVVNHGIGVEVLERMVRAIKGFHEQPPEIKAPVYRRENAKGVSYISNIDLFHSK--AASWRDTLQIRLGLTEPELEEVPEICRKEAVEWNHHVKQXXXXXXXXXXXXXXXKTDRLKEKTFLEGRMMVGHYYPXLSQPD 704
            ESYD+  E+K FD+             T +P+ F+ PP      + ++K      V P IDL G+D D ++   IV+K+  AS + GFFQVVNHGI   VL+R ++  + F EQ  E+K   Y R+ AK V Y SN+DL+ S   AASWRDT+   +    P L+E P  C +  ++++  VK+                   LK+           +YYP   QP+
Sbjct:    8 ESYDKMSELKAFDDTKAGVKGLVDSGITKVPQIFVLPP------KDRAKKCETHFVFPVIDLQGIDEDPIKHKEIVDKVRDASEKWGFFQVVNHGIPTSVLDRTLQGTRQFFEQDNEVKKQYYTRDTAKKVVYTSNLDLYKSSVPAASWRDTIFCYMAPNPPSLQEFPTPCGESLIDFSKDVKKLGFTLLELLSEGLGLDRSYLKDYMDCFHLFCSCNYYPPCPQPE 228          
The following BLAST results are available for this feature:
BLAST of FC920684 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 6
Match NameE-valueIdentityDescription
ACCH1_ARATH2.907e-3537.841-aminocyclopropane-1-carboxylate oxidase homolog ... [more]
ACCH2_ARATH4.958e-3534.631-aminocyclopropane-1-carboxylate oxidase homolog ... [more]
GSL_ARATH6.476e-3534.22Probable 2-oxoacid dependent dioxygenase OS=Arabid... [more]
ACCH3_ARATH8.458e-3533.931-aminocyclopropane-1-carboxylate oxidase homolog ... [more]
DV4H_CATRO6.701e-3235.19Deacetoxyvindoline 4-hydroxylase OS=Catharanthus r... [more]
ACCH3_SOLLC5.310e-2933.921-aminocyclopropane-1-carboxylate oxidase homolog ... [more]
back to top
Properties
Property NameValue
Genbank descriptionC32011G02EF RVDevelop1 Citrus clementina cDNA clone C32011G02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920684 ID=FC920684|Name=FC920684|organism=Citrus clementina|type=EST|length=706bp
GAATAACAAGAAGAGCTACAACCATGAGCCTAGAATCATACGACAGGGCC
AAAGAAGTGAAACGATTCGACGAGCCCAAAGTCGGGGTCAAAGGTTTAGT
TGACTTGGGCGTCACCGCCATCCCCCGCTTTTTCATCCACCCACCCGCCA
CTCTTGCCGATCTCAGACCCAAGTCAAAGACCCGGCCCGTCTCTGATGTA
GTCCCCACCATCGATTTATCGGGCGTTGACTCGGACGATCTGCGGCCGAC
GATTGTGGAAAAGATAGCATGTGCCTCGCGGGAGCTGGGGTTCTTTCAGG
TTGTGAATCACGGCATCGGAGTTGAGGTCTTGGAGCGTATGGTTCGGGCC
ATTAAAGGGTTTCATGAACAGCCGCCGGAGATCAAGGCGCCGGTGTATCG
TAGGGAGAACGCCAAAGGCGTGTCTTACATTTCCAACATCGATTTGTTTC
ACTCTAAAGCTGCCAGCTGGAGGGACACACTGCAGATAAGGCTAGGTCTG
ACGGAACCAGAGCTTGAAGAAGTTCCTGAAATATGTAGGAAAGAGGCAGT
CGAGTGGAACCACCATGTAAAACAGCTCGGAGAGCTTTTGTTTGGGCTGC
TGTGTGAAGGTTTGGGGTTGAAAACCGATAGGTTGAAGGAAAAGACCTTC
CTGGAAGGGAGGATGATGGTGGGCCATTATTATCCCNTACTGTCGCAGCC
TGATCT
back to top