FC920691

Overview
NameFC920691
Unique NameFC920691
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length720
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC920691 vs. ExPASy Swiss-Prot
Match: CHSY_VITVI (Chalcone synthase OS=Vitis vinifera GN=CHS PE=2 SV=1)

HSP 1 Score: 323.168 bits (827), Expect = 8.930e-88
Identity = 153/228 (67.11%), Postives = 187/228 (82.02%), Query Frame = 1
Query:   37 MEKVKDGKNQQQGGGLATILAIGTANPPNCIYQADYPDYYFRVTNSDHMTLLKQKFKRICEKSNVKKRYFHVTEDILKKNPNICAYDGSSLDSRQDILVREVPKLGEEAATKAIKEWGQSKSQITHLIFCSLVGVDMPGADYQLTKMLGLNPSVKRVMLYFQGCYIGATAIRMAKDFAENNPGTRVLVVCSDLSLGTFRGPSDANLGCLAGQAPSSRRAAALIIGANP 720
            M  V + +  Q+  G AT+LAIGTA P NC+YQADYPDYYFR+TNS+HMT LK+KFKR+CEKS + KRY H+TE+ILK+NPN+CAY   SLD+RQD++V EVPKLG+EAA KAIKEWGQ KS+ITHL+FC+  GVDMPGADYQLTK+LGL PSVKR+M+Y QGC+ G T +R+AKD AENN G+RVLVVCS+++  TFRGPSD +L  L GQA     AAA+IIGA+P
Sbjct:    1 MVSVAEIRKAQRAEGPATVLAIGTATPANCVYQADYPDYYFRITNSEHMTELKEKFKRMCEKSMINKRYMHLTEEILKENPNVCAYMAPSLDARQDMVVVEVPKLGKEAAAKAIKEWGQPKSKITHLVFCTTSGVDMPGADYQLTKLLGLKPSVKRLMMYQQGCFAGGTVLRLAKDLAENNAGSRVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGADP 228          
BLAST of FC920691 vs. ExPASy Swiss-Prot
Match: CHSY_PETCR (Chalcone synthase OS=Petroselinum crispum GN=CHS PE=3 SV=1)

HSP 1 Score: 321.242 bits (822), Expect = 3.393e-87
Identity = 149/226 (65.93%), Postives = 189/226 (83.63%), Query Frame = 1
Query:   43 KVKDGKNQQQGGGLATILAIGTANPPNCIYQADYPDYYFRVTNSDHMTLLKQKFKRICEKSNVKKRYFHVTEDILKKNPNICAYDGSSLDSRQDILVREVPKLGEEAATKAIKEWGQSKSQITHLIFCSLVGVDMPGADYQLTKMLGLNPSVKRVMLYFQGCYIGATAIRMAKDFAENNPGTRVLVVCSDLSLGTFRGPSDANLGCLAGQAPSSRRAAALIIGANP 720
            ++++ +N+Q+  G A ILAIGTA P NC+YQADYPDYYFR+TNS+HMT LK KFKR+CEKS ++KRY H+TE+ LK+NPN+CAY+  SLD+RQD++V EVP+LG+EAA+KAIKEWGQ KS+ITHLIFC+  GVDMPGADYQLTK+LGL PSVKR M+Y QGC+ G T +R+AKD AENN G RVLVVCS+++  TFRGPSD++L  L GQA     AAA+I+G++P
Sbjct:    8 EIEEIRNRQRAQGPANILAIGTATPSNCVYQADYPDYYFRITNSEHMTDLKLKFKRMCEKSMIRKRYMHITEEYLKENPNVCAYEAPSLDARQDLVVVEVPRLGKEAASKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNAGARVLVVCSEITAVTFRGPSDSHLDSLVGQALFGDGAAAVILGSDP 233          
BLAST of FC920691 vs. ExPASy Swiss-Prot
Match: CHS2_DAUCA (Chalcone synthase 2 OS=Daucus carota GN=CHS2 PE=2 SV=1)

HSP 1 Score: 315.464 bits (807), Expect = 1.862e-85
Identity = 146/226 (64.60%), Postives = 186/226 (82.30%), Query Frame = 1
Query:   43 KVKDGKNQQQGGGLATILAIGTANPPNCIYQADYPDYYFRVTNSDHMTLLKQKFKRICEKSNVKKRYFHVTEDILKKNPNICAYDGSSLDSRQDILVREVPKLGEEAATKAIKEWGQSKSQITHLIFCSLVGVDMPGADYQLTKMLGLNPSVKRVMLYFQGCYIGATAIRMAKDFAENNPGTRVLVVCSDLSLGTFRGPSDANLGCLAGQAPSSRRAAALIIGANP 720
            ++++ + +Q+  G A ILAIGTA P NC+YQADYPDYYFR+TNS+HM+ LK KFKR+CEKS ++KRY H+TE+ LK+NPN+CAY+  SLD+RQD++V EVP+LG+EAA KAIKEWG  KS+ITHLIFC+  GVDMPGADYQLTK+LGL PSVKR M+Y QGC+ G T +R+AKD AENN G RVLVVCS+++  TFRGPSD++L  L GQA     AAA+I+G++P
Sbjct:    7 EIEEIRKRQRAQGPANILAIGTATPSNCVYQADYPDYYFRITNSEHMSDLKLKFKRMCEKSMIRKRYMHITEEYLKENPNVCAYEAPSLDARQDLVVVEVPRLGKEAAAKAIKEWGHPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNTGARVLVVCSEITAVTFRGPSDSHLDSLVGQALFGDGAAAVIVGSDP 232          
BLAST of FC920691 vs. ExPASy Swiss-Prot
Match: CHS2_CAMSI (Chalcone synthase 2 OS=Camellia sinensis GN=CHS2 PE=2 SV=1)

HSP 1 Score: 315.079 bits (806), Expect = 2.432e-85
Identity = 147/228 (64.47%), Postives = 188/228 (82.46%), Query Frame = 1
Query:   37 MEKVKDGKNQQQGGGLATILAIGTANPPNCIYQADYPDYYFRVTNSDHMTLLKQKFKRICEKSNVKKRYFHVTEDILKKNPNICAYDGSSLDSRQDILVREVPKLGEEAATKAIKEWGQSKSQITHLIFCSLVGVDMPGADYQLTKMLGLNPSVKRVMLYFQGCYIGATAIRMAKDFAENNPGTRVLVVCSDLSLGTFRGPSDANLGCLAGQAPSSRRAAALIIGANP 720
            M  V++ +  Q+  G AT++AIGTA PPNC+ Q+ YPDYYFR+TNS+H T LK+KF+R+C+KS +KKRY ++TE+ILK+NPN+CAY   SLD+RQD++V EVPKLG+EAATKAIKEWGQ KS+ITHL+FC+  GVDMPGADYQLTK+LGL PSVKR+M+Y QGC+ G T +R+AKD AENN G RVLVVCS+++  TFRGPSDA+L  L GQA     AAA+I+G++P
Sbjct:    1 MVTVEEVRRAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHKTELKEKFQRMCDKSMIKKRYMYLTEEILKENPNVCAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAAIIVGSDP 228          
BLAST of FC920691 vs. ExPASy Swiss-Prot
Match: CHS2_SOLLC (Chalcone synthase 2 OS=Solanum lycopersicum GN=CHS2 PE=2 SV=2)

HSP 1 Score: 314.309 bits (804), Expect = 4.148e-85
Identity = 149/228 (65.35%), Postives = 185/228 (81.14%), Query Frame = 1
Query:   37 MEKVKDGKNQQQGGGLATILAIGTANPPNCIYQADYPDYYFRVTNSDHMTLLKQKFKRICEKSNVKKRYFHVTEDILKKNPNICAYDGSSLDSRQDILVREVPKLGEEAATKAIKEWGQSKSQITHLIFCSLVGVDMPGADYQLTKMLGLNPSVKRVMLYFQGCYIGATAIRMAKDFAENNPGTRVLVVCSDLSLGTFRGPSDANLGCLAGQAPSSRRAAALIIGANP 720
            M  V++ +  Q+  G ATI+AIGTA P NC+ Q+ YPDYYFR+TNS+HMT LK+KFKR+C+KS + KRY H+TE+ILK+NPNIC Y   SLD+RQDI+V EVPKLG+EAA KAIKEWGQ KS+ITH++FC+  GVDMPGADYQLTK+LGL PSVKR+M+Y QGC+ G T IR+AKD AENN G RVLVVCS+++  TFRGPSD +L  + GQA    RAAA+IIG++P
Sbjct:    1 MVTVEEVRRAQRAKGPATIMAIGTATPSNCVDQSTYPDYYFRITNSEHMTELKEKFKRMCDKSMINKRYMHLTEEILKENPNICEYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHVVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVIRLAKDLAENNKGARVLVVCSEITAVTFRGPSDTHLDSMVGQALFGDRAAAMIIGSDP 228          
BLAST of FC920691 vs. ExPASy Swiss-Prot
Match: CHSY_PUELO (Chalcone synthase OS=Pueraria lobata GN=CHS PE=2 SV=1)

HSP 1 Score: 313.923 bits (803), Expect = 5.417e-85
Identity = 150/228 (65.79%), Postives = 185/228 (81.14%), Query Frame = 1
Query:   37 MEKVKDGKNQQQGGGLATILAIGTANPPNCIYQADYPDYYFRVTNSDHMTLLKQKFKRICEKSNVKKRYFHVTEDILKKNPNICAYDGSSLDSRQDILVREVPKLGEEAATKAIKEWGQSKSQITHLIFCSLVGVDMPGADYQLTKMLGLNPSVKRVMLYFQGCYIGATAIRMAKDFAENNPGTRVLVVCSDLSLGTFRGPSDANLGCLAGQAPSSRRAAALIIGANP 720
            M  V + +  Q+  G ATILAIGTANPPNC+ Q+ YPDYYFR+TNS+HMT LK+KF+R+C+KS +KKRY ++TE+ILK+NPN+CAY   SLD+RQD++V EVPKLG+EAATKAIKEWGQ KS+ITHLIFC+  GVDMPGADYQLTK LGL P VKR M+Y QGC+ G T +R+AKD AENN G RVLVVCS+++  TFRGPSD +L  L GQA     AAA+I+G++P
Sbjct:    1 MVSVAEIRQAQRAEGPATILAIGTANPPNCVDQSTYPDYYFRITNSEHMTELKEKFQRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKQLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIVGSDP 228          
BLAST of FC920691 vs. ExPASy Swiss-Prot
Match: CHS3_SOYBN (Chalcone synthase 3 OS=Glycine max GN=CHS3 PE=3 SV=1)

HSP 1 Score: 313.923 bits (803), Expect = 5.417e-85
Identity = 147/228 (64.47%), Postives = 187/228 (82.02%), Query Frame = 1
Query:   37 MEKVKDGKNQQQGGGLATILAIGTANPPNCIYQADYPDYYFRVTNSDHMTLLKQKFKRICEKSNVKKRYFHVTEDILKKNPNICAYDGSSLDSRQDILVREVPKLGEEAATKAIKEWGQSKSQITHLIFCSLVGVDMPGADYQLTKMLGLNPSVKRVMLYFQGCYIGATAIRMAKDFAENNPGTRVLVVCSDLSLGTFRGPSDANLGCLAGQAPSSRRAAALIIGANP 720
            M  V++ +N Q+  G AT++AIGTA PPNC+ Q+ YPDYYFR+TNS+HMT LK+KFKR+C+KS +KKRY ++ E+ILK+NP++CAY   SLD+RQD++V EVPKLG+EAATKAIKEWGQ KS+ITHLIFC+  GVDMPGADYQLTK+LGL PSVKR M+Y QGC+ G T +R+AKD AENN G RVLVVCS+++  TFRGP+D +L  L GQA     AAA+I+G++P
Sbjct:    1 MVSVEEIRNAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHMTELKEKFKRMCDKSMIKKRYMYLNEEILKENPSVCAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPSVKRYMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPTDTHLDSLVGQALFGDGAAAVIVGSDP 228          
BLAST of FC920691 vs. ExPASy Swiss-Prot
Match: CHS1_HORVU (Chalcone synthase 1 OS=Hordeum vulgare GN=CHS1 PE=3 SV=1)

HSP 1 Score: 313.923 bits (803), Expect = 5.417e-85
Identity = 147/225 (65.33%), Postives = 185/225 (82.22%), Query Frame = 1
Query:   46 VKDGKNQQQGGGLATILAIGTANPPNCIYQADYPDYYFRVTNSDHMTLLKQKFKRICEKSNVKKRYFHVTEDILKKNPNICAYDGSSLDSRQDILVREVPKLGEEAATKAIKEWGQSKSQITHLIFCSLVGVDMPGADYQLTKMLGLNPSVKRVMLYFQGCYIGATAIRMAKDFAENNPGTRVLVVCSDLSLGTFRGPSDANLGCLAGQAPSSRRAAALIIGANP 720
            V++ +N Q+  G AT+LAIGTA P NC+YQADYPDYYF++T SDHM  LK+KFKR+C+KS ++KRY H+TE+IL++NPN+CAY   SLD+RQDI+V EVPKLG+ AA KAIKEWGQ +S+ITHL+FC+  GVDMPGADYQLTKMLGL PSVKR+M+Y QGC+ G T +R+AKD AENN G RVLVVCS+++  TFRGP +++L  L GQA     AAA+IIGA+P
Sbjct:    7 VEEVRNAQRAEGPATVLAIGTATPANCVYQADYPDYYFKITKSDHMADLKEKFKRMCDKSQIRKRYMHLTEEILEENPNMCAYMAPSLDARQDIVVVEVPKLGKAAAQKAIKEWGQPRSKITHLVFCTTSGVDMPGADYQLTKMLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNRGARVLVVCSEITAVTFRGPHESHLDSLVGQALFGDGAAAVIIGADP 231          
BLAST of FC920691 vs. ExPASy Swiss-Prot
Match: CHSE_IPONI (Chalcone synthase E OS=Ipomoea nil GN=CHSE PE=2 SV=1)

HSP 1 Score: 313.538 bits (802), Expect = 7.075e-85
Identity = 151/228 (66.23%), Postives = 185/228 (81.14%), Query Frame = 1
Query:   37 MEKVKDGKNQQQGGGLATILAIGTANPPNCIYQADYPDYYFRVTNSDHMTLLKQKFKRICEKSNVKKRYFHVTEDILKKNPNICAYDGSSLDSRQDILVREVPKLGEEAATKAIKEWGQSKSQITHLIFCSLVGVDMPGADYQLTKMLGLNPSVKRVMLYFQGCYIGATAIRMAKDFAENNPGTRVLVVCSDLSLGTFRGPSDANLGCLAGQAPSSRRAAALIIGANP 720
            M  V++ +  Q+  G ATI+AIGT+ P NC+ Q+ YPDYYFR+TNS+H+  LK+KFKR+CEKS +KKRY ++TE+ILK+NPNICAY   SLD+RQDI+V EVPKLG+EAA KAIKEWGQ KS+ITHL+FC+  GVDMPGADYQLTK+LGL PSVKR M+Y QGC+ G T IR+AKD AENN G RVLVVCS+++  TFRGPSDA+L  L GQA     AAALIIG++P
Sbjct:    1 MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMCEKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAENNKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDP 228          
BLAST of FC920691 vs. ExPASy Swiss-Prot
Match: CHSY_BETVE (Chalcone synthase OS=Betula verrucosa GN=CHS PE=2 SV=2)

HSP 1 Score: 312.768 bits (800), Expect = 1.207e-84
Identity = 149/228 (65.35%), Postives = 184/228 (80.70%), Query Frame = 1
Query:   37 MEKVKDGKNQQQGGGLATILAIGTANPPNCIYQADYPDYYFRVTNSDHMTLLKQKFKRICEKSNVKKRYFHVTEDILKKNPNICAYDGSSLDSRQDILVREVPKLGEEAATKAIKEWGQSKSQITHLIFCSLVGVDMPGADYQLTKMLGLNPSVKRVMLYFQGCYIGATAIRMAKDFAENNPGTRVLVVCSDLSLGTFRGPSDANLGCLAGQAPSSRRAAALIIGANP 720
            M  V++ +  Q+  G AT+LAIGTA P NCI QADYPDYYFR+T SDHMT LK+KFKR+C+KS +KKRY ++ E+IL +NPN+CAY   SLD+RQ I+V EVPKLG+EAATKAIKEWGQ KS+ITHL+FC+  GVDMPGADYQLTK+LGL PSVKR+M+Y QGC+ G T +R+AKD AENN G RVLVVCS+++  TFRGP+D +L  L GQA     AAA+I+GA+P
Sbjct:    1 MASVEEIRKAQRAHGPATVLAIGTATPSNCITQADYPDYYFRITKSDHMTELKEKFKRMCDKSMIKKRYMYLNEEILNENPNMCAYMAPSLDARQTIVVVEVPKLGKEAATKAIKEWGQPKSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPTDTHLDSLVGQALFGDGAAAVIVGADP 228          
The following BLAST results are available for this feature:
BLAST of FC920691 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 145
Match NameE-valueIdentityDescription
CHSY_VITVI8.930e-8867.11Chalcone synthase OS=Vitis vinifera GN=CHS PE=2 SV... [more]
CHSY_PETCR3.393e-8765.93Chalcone synthase OS=Petroselinum crispum GN=CHS P... [more]
CHS2_DAUCA1.862e-8564.60Chalcone synthase 2 OS=Daucus carota GN=CHS2 PE=2 ... [more]
CHS2_CAMSI2.432e-8564.47Chalcone synthase 2 OS=Camellia sinensis GN=CHS2 P... [more]
CHS2_SOLLC4.148e-8565.35Chalcone synthase 2 OS=Solanum lycopersicum GN=CHS... [more]
CHSY_PUELO5.417e-8565.79Chalcone synthase OS=Pueraria lobata GN=CHS PE=2 S... [more]
CHS3_SOYBN5.417e-8564.47Chalcone synthase 3 OS=Glycine max GN=CHS3 PE=3 SV... [more]
CHS1_HORVU5.417e-8565.33Chalcone synthase 1 OS=Hordeum vulgare GN=CHS1 PE=... [more]
CHSE_IPONI7.075e-8566.23Chalcone synthase E OS=Ipomoea nil GN=CHSE PE=2 SV... [more]
CHSY_BETVE1.207e-8465.35Chalcone synthase OS=Betula verrucosa GN=CHS PE=2 ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32011G11EF RVDevelop1 Citrus clementina cDNA clone C32011G11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920691 ID=FC920691|Name=FC920691|organism=Citrus clementina|type=EST|length=720bp
GGAGACGTGTTCATCAAAATCTCGGTTGAATATATAATGGAGAAAGTTAA
AGATGGGAAGAACCAACAGCAAGGAGGAGGGTTAGCCACGATCCTAGCCA
TCGGCACTGCAAATCCACCAAACTGCATATACCAAGCTGACTACCCTGAT
TATTACTTCCGTGTCACCAACAGTGACCACATGACTCTCCTCAAACAAAA
ATTCAAACGCATCTGCGAGAAATCAAATGTGAAGAAACGCTACTTCCATG
TTACCGAAGATATTCTCAAAAAGAACCCAAATATATGTGCCTACGACGGC
TCCTCCCTCGATAGCCGTCAAGATATATTGGTTAGGGAAGTACCGAAACT
TGGCGAGGAAGCGGCAACAAAAGCAATCAAAGAATGGGGCCAATCAAAAT
CCCAGATCACGCATCTCATTTTCTGCTCACTTGTGGGCGTAGACATGCCC
GGGGCTGACTATCAGCTGACCAAAATGTTGGGCCTCAACCCATCTGTCAA
ACGAGTCATGCTATACTTTCAAGGCTGTTACATTGGCGCCACAGCCATCC
GAATGGCCAAGGACTTTGCTGAAAACAACCCTGGTACCCGCGTTCTAGTC
GTATGCTCTGACTTATCCCTTGGTACTTTCCGTGGACCTTCTGATGCCAA
CTTAGGCTGCCTTGCAGGCCAAGCCCCCTCTTCGCGACGCGCCGCAGCTT
TAATCATTGGCGCTAATCCT
back to top