FC920692

Overview
NameFC920692
Unique NameFC920692
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length662
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14096 contig Ccv1_Contig14096:726..1387. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920692 vs. ExPASy Swiss-Prot
Match: PROD_ARATH (Proline dehydrogenase, mitochondrial OS=Arabidopsis thaliana GN=POX PE=1 SV=2)

HSP 1 Score: 278.87 bits (712), Expect = 1.647e-74
Identity = 132/211 (62.56%), Postives = 173/211 (81.99%), Query Frame = 3
Query:    3 VSDLLIWQQRDPSFNLPWKLNNFPLFSDCSPLYHTLQKPEPLTLQEENELQSAHQRLQKLCQECLEANVPLTVDAEDTFVQPAIDYLTYNAALS-NNKAGKPIVYNTIQAYLKDAKERLFLATEAAEKMGVPMGFKLVRGAYMSSESKLAASLGFDSPIHNSIQETHACYNDCASYMLEKIADGSG-AVVLATHNVESGQLAAAKATDLGI 629
            VSDLL W+ + P+F L WKL +FP+FS+ SPLYHT  +PEPLT +EE EL++AH R+Q++C++C E+NVPL +DAEDT +QPAIDY+ Y++A+  N    +PIVYNTIQAYL+DA ERL LA + AEK  VPMGFKLVRGAYMSSE+ LA SLG  SP+H++IQ+TH+CYNDC ++++EK ++GSG  VVLATHN +SG+LA+ KA+DLGI
Sbjct:  209 VSDLLRWEYKSPNFKLSWKLKSFPVFSESSPLYHTNSEPEPLTAEEERELEAAHGRIQEICRKCQESNVPLLIDAEDTILQPAIDYMAYSSAIMFNADKDRPIVYNTIQAYLRDAGERLHLAVQNAEKENVPMGFKLVRGAYMSSEASLADSLGCKSPVHDTIQDTHSCYNDCMTFLMEKASNGSGFGVVLATHNADSGRLASRKASDLGI 419          
BLAST of FC920692 vs. ExPASy Swiss-Prot
Match: PROD_HUMAN (Proline dehydrogenase, mitochondrial OS=Homo sapiens GN=PRODH PE=1 SV=2)

HSP 1 Score: 115.931 bits (289), Expect = 1.846e-25
Identity = 69/175 (39.43%), Postives = 103/175 (58.86%), Query Frame = 3
Query:  120 EPLTLQ--EENELQSAH--QRLQKLCQECLEANVPLTVDAEDTFVQPAIDYLTYNAALSNNKAGKPIVYNTIQAYLKDAKERLFLATEAAEKMGVPMGFKLVRGAYMSSESKLAASLGFDSPIHNSIQETHACYNDCASYMLEKIADGSGA-VVLATHNVESGQLAAAKATDLGI 629
            EPL  +  EE ELQ     QR+  L ++  E  V L VDAE T+ QPAI  LT       N   KP+++NT Q YLKDA + + L  E A + G   G KLVRGAY++ E   AA +G++ PI+ + + T+A Y+ C  Y+LE++   + A V++A+HN ++ + A  +  +LG+
Sbjct:  258 EPLLSRFTEEEELQMTRMLQRMDVLAKKATEMGVRLMVDAEQTYFQPAISRLTLEMQRKFN-VEKPLIFNTYQCYLKDAYDNVTLDVELARREGWCFGAKLVRGAYLAQERARAAEIGYEDPINPTYEATNAMYHRCLDYVLEELKHNAKAKVMVASHNEDTVRFALRRMEELGL 431          
BLAST of FC920692 vs. ExPASy Swiss-Prot
Match: PROD_MOUSE (Proline dehydrogenase, mitochondrial OS=Mus musculus GN=Prodh PE=2 SV=1)

HSP 1 Score: 111.694 bits (278), Expect = 3.482e-24
Identity = 64/175 (36.57%), Postives = 102/175 (58.29%), Query Frame = 3
Query:  120 EPL----TLQEENELQSAHQRLQKLCQECLEANVPLTVDAEDTFVQPAIDYLTYNAALSNNKAGKPIVYNTIQAYLKDAKERLFLATEAAEKMGVPMGFKLVRGAYMSSESKLAASLGFDSPIHNSIQETHACYNDCASYMLEKIADGSGA-VVLATHNVESGQLAAAKATDLGI 629
            EPL    T +EE +++   QR+  L ++  EA V L +DAE ++ QPAI  LT       N   KP ++NT Q YLKDA + + L  E A + G   G KLVR AYM+ E   AA +G++ PI+ + + T+A Y+ C +Y+LE++   + A V++A+HN ++      +  ++G+
Sbjct:  239 EPLLSRFTEEEEQQMKRMLQRMDVLAKKAKEAGVRLMIDAEQSYFQPAISRLTLEMQRRFN-VDKPFIFNTFQCYLKDAYDNVTLDMELARREGWCSGAKLVRRAYMAQERVRAAEIGYEDPINPTYEATNAMYHRCLNYVLEELKHSTKAEVMVASHNEDTVHFTLCRMKEIGL 412          
BLAST of FC920692 vs. ExPASy Swiss-Prot
Match: PROD_DICDI (Proline dehydrogenase, mitochondrial OS=Dictyostelium discoideum GN=prodh PE=3 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 2.113e-21
Identity = 65/195 (33.33%), Postives = 107/195 (54.87%), Query Frame = 3
Query:   45 NLPWKLNNFPLFSDCSPLYHTL--------QKPEPL-TLQEENELQSAHQRLQKLCQECLEANVPLTVDAEDTFVQPAIDYLTYNAALSNNKAGKPIVYNTIQAYLKDAKERL--FLATEAAEKMGVPMGFKLVRGAYMSSESKLAASLGFDSPIHNSIQETHACYNDCASYMLEKIADGSGAV--VLATHNVES 590
            N+   ++  P+ S  SPL   L        Q  EPL T ++  E++    R+ K+ Q C +  VP+ VDAE ++ Q AI +LT + ++  NK  KPI+YNT Q YL +    L       +++K    +G K+VRGAYM +ES+ +  L  ++P+  +IQ+TH  YN    ++L +I     ++  ++A+HN +S
Sbjct:  289 NVTTNVSELPIESFNSPLDFYLNQSSSLMKQGSEPLLTSKDIKEIKEFFNRMDKIFQLCHQRGVPILVDAEQSYYQVAIHHLTMSYSIKYNKE-KPIIYNTYQMYLVNGMNVLKQHFELSSSQKFNFKLGAKIVRGAYMVTESERSQRLSTENPVLPTIQDTHKSYNTALDFLLNQIKSDPNSIGLMIASHNEDS 482          
BLAST of FC920692 vs. ExPASy Swiss-Prot
Match: PROD2_BOVIN (Probable proline dehydrogenase 2 OS=Bos taurus GN=PRODH2 PE=2 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 3.984e-20
Identity = 61/172 (35.47%), Postives = 91/172 (52.91%), Query Frame = 3
Query:  126 LTLQEENELQSAHQRLQKLCQECLEANVPLTVDAEDTFVQPAIDYLTYNAALSNNKAGK--PIVYNTIQAYLKDAKERLFLATEAAEKMGVPMGFKLVRGAYMSSESKLAASLGFDSPIHNSIQETHACYNDCASYMLEKIADGSGA--VVLATHNVESGQLAAAKATDLGI 629
            L  ++   LQ++  RL ++ Q      V L VDAE T + PA+  L    A   N +G+  P V+NT QAYLKD  ERL    EAA++ G+  G KLVRGAY+  E + A   G + P     + T   Y+ C   ML +++       +++A+HN +S + A  +  +LGI
Sbjct:  206 LNTEQTRHLQASLSRLHRVVQHARAQRVRLLVDAEYTSLNPALSLLVAALATRWNSSGEGGPWVWNTYQAYLKDTYERLRWDAEAADRAGLAFGVKLVRGAYLDKERETARLQGTEDPTQPDYEATSQSYSRCLELMLTQVSHRGPMCHLMVASHNEDSVRQATKRMWELGI 377          
BLAST of FC920692 vs. ExPASy Swiss-Prot
Match: PROD2_MOUSE (Probable proline dehydrogenase 2 OS=Mus musculus GN=Prodh2 PE=2 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 1.159e-19
Identity = 61/172 (35.47%), Postives = 90/172 (52.33%), Query Frame = 3
Query:  126 LTLQEENELQSAHQRLQKLCQECLEANVPLTVDAEDTFVQPAIDYLTYNAALSNN--KAGKPIVYNTIQAYLKDAKERLFLATEAAEKMGVPMGFKLVRGAYMSSESKLAASLGFDSPIHNSIQETHACYNDCASYMLEKIADGSGA--VVLATHNVESGQLAAAKATDLGI 629
            L+ ++   LQ++  RL ++ Q      V L VDAE TF+ PA+  L    A+  N  + G P V+NT QAYLKD  +RL    EAA K G+  G KLVRGAY+  E  +    G +       + T   Y+ C   ML  +++      +++A+HN ES + A  +  +LGI
Sbjct:  206 LSTEQNQHLQASLSRLHRVAQHARAKCVRLLVDAEYTFINPALSLLVAALAVRWNSPEEGGPWVWNTYQAYLKDTHQRLEQDAEAAHKAGLAFGVKLVRGAYLDKERSMTQLQGKEDCTQPDYEATSRSYSRCLELMLRCVSNHGPPCHLMVASHNEESVRQATKRMWELGI 377          
BLAST of FC920692 vs. ExPASy Swiss-Prot
Match: PROD2_XENLA (Probable proline dehydrogenase 2 OS=Xenopus laevis GN=prodh2 PE=2 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 1.977e-19
Identity = 59/172 (34.30%), Postives = 93/172 (54.07%), Query Frame = 3
Query:  138 EENELQSAHQRLQKLCQECLEANVPLTVDAEDTFVQPAIDYLTYNAALSNNKAGKPIVYNTIQAYLKDAKERLFLATEAAEKMGVPMGFKLVRGAYMSSESKLAASLGFDSPIHNSIQETHACYNDCASYMLEKIADGSGA--VVLATHNVESGQLAAAKATDLGI-KGTRS 644
            E + L+++ +RL ++ +      V + VDAE T++ PA+  +T  A +S     +P ++NT Q YLKD+   L L  + A  +G+  G KLVRGAYM  E KL+   G+  PI +  + T+  Y      ML+ I        +++A+HN ES   A  +  +LGI KG+ S
Sbjct:  223 ENSHLRNSVRRLSRIAKHATANRVRVLVDAEYTYMNPALSLVTM-AMMSQCNQSEPWIWNTYQCYLKDSFSLLSLDLDTARSLGLCFGVKLVRGAYMDKERKLSKQKGYADPIQHDWEATNRSYQRSLDKMLDLIGQNGQRHNLIVASHNEESVLHAVTRMAELGIDKGSGS 393          
BLAST of FC920692 vs. ExPASy Swiss-Prot
Match: PROD2_RAT (Probable proline dehydrogenase 2 OS=Rattus norvegicus GN=Prodh2 PE=2 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 2.583e-19
Identity = 59/172 (34.30%), Postives = 92/172 (53.49%), Query Frame = 3
Query:  126 LTLQEENELQSAHQRLQKLCQECLEANVPLTVDAEDTFVQPAIDYLTYNAA--LSNNKAGKPIVYNTIQAYLKDAKERLFLATEAAEKMGVPMGFKLVRGAYMSSESKLAASLGFDSPIHNSIQETHACYNDCASYMLEKIADGSGA--VVLATHNVESGQLAAAKATDLGI 629
            L+ ++   LQ++  RL ++ Q     +V L VDAE TF+ PA+  L    A  L +++   P V+NT QAYLKD  ERL    +AA + G+  G KLVRGAY+  E  +    G +       + T   Y+ C   ML ++++      +++A+HN ES + A  +  +LGI
Sbjct:  206 LSTEQNQHLQASLSRLHRVAQHARAQDVRLLVDAEYTFINPALSLLVAALAMRLDSSEEEGPWVWNTYQAYLKDTHERLERDAKAAHEAGLAFGVKLVRGAYLDKERSVTQLHGKEDCTQPDYEATSRSYSRCLELMLRRVSNHGPRCHLMVASHNEESIRQATRRMWELGI 377          
BLAST of FC920692 vs. ExPASy Swiss-Prot
Match: PROD2_HUMAN (Probable proline dehydrogenase 2 OS=Homo sapiens GN=PRODH2 PE=2 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 7.514e-19
Identity = 61/172 (35.47%), Postives = 89/172 (51.74%), Query Frame = 3
Query:  126 LTLQEENELQSAHQRLQKLCQECLEANVPLTVDAEDTFVQPAIDYLTYNAALSNNKAGK--PIVYNTIQAYLKDAKERLFLATEAAEKMGVPMGFKLVRGAYMSSESKLAASLGFDSPIHNSIQETHACYNDCASYMLEKIADGSGA--VVLATHNVESGQLAAAKATDLGI 629
            L  ++   L+++  RL ++ Q     +V L VDAE T + PA+  L    A+  N  G+  P V+NT QA LKD  ERL    EAA + G+  G KLVRGAY+  E  +A   G + P     + T   Y+ C   ML  +A       +++A+HN ES + A  +  +LGI
Sbjct:  282 LNAEQNQHLRASLSRLHRVAQYARAQHVRLLVDAEYTSLNPALSLLVAALAVRWNSPGEGGPWVWNTYQACLKDTFERLGRDAEAAHRAGLAFGVKLVRGAYLDKERAVAQLHGMEDPTQPDYEATSQSYSRCLELMLTHVARHGPMCHLMVASHNEESVRQATKRMWELGI 453          
BLAST of FC920692 vs. ExPASy Swiss-Prot
Match: PROD_CAEEL (Proline dehydrogenase, mitochondrial OS=Caenorhabditis elegans GN=B0513.5 PE=3 SV=2)

HSP 1 Score: 92.4337 bits (228), Expect = 2.186e-18
Identity = 51/162 (31.48%), Postives = 91/162 (56.17%), Query Frame = 3
Query:  126 LTLQEENELQSAHQRLQKLCQECLEANVPLTVDAEDTFVQPAIDYLTYNAALSNNKAGKPIVYNTIQAYLKDAKERLFLATEAAEKMGVPMGFKLVRGAYMSSESKLAASLGFDSPIHNSIQETHACYNDCASYMLEKI---ADGSGAVVLATHNVESGQLA 602
            L+ +EE E ++  +R   + +  +E  V + VDAE T++QPAI  +T       NK G+  ++NT QAYLK   + +    + A + G   G KLVRGAYM  E   A ++G++ PI+++ + T   Y  C + + +++      + +V++A+HN ++ + A
Sbjct:  359 LSNEEEQEFRNMVRRTLDVAEYAIEKGVRIMVDAEQTYLQPAISKITIEMMKKYNK-GRGNIFNTYQAYLKGTLQNMEADMQVARREGWHFGAKLVRGAYMEQERARAKAIGYEDPINDNFEATSKMYESCLTRIADEVHRRGKTNVSVMVASHNEDTVRFA 519          
The following BLAST results are available for this feature:
BLAST of FC920692 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 12
Match NameE-valueIdentityDescription
PROD_ARATH1.647e-7462.56Proline dehydrogenase, mitochondrial OS=Arabidopsi... [more]
PROD_HUMAN1.846e-2539.43Proline dehydrogenase, mitochondrial OS=Homo sapie... [more]
PROD_MOUSE3.482e-2436.57Proline dehydrogenase, mitochondrial OS=Mus muscul... [more]
PROD_DICDI2.113e-2133.33Proline dehydrogenase, mitochondrial OS=Dictyostel... [more]
PROD2_BOVIN3.984e-2035.47Probable proline dehydrogenase 2 OS=Bos taurus GN=... [more]
PROD2_MOUSE1.159e-1935.47Probable proline dehydrogenase 2 OS=Mus musculus G... [more]
PROD2_XENLA1.977e-1934.30Probable proline dehydrogenase 2 OS=Xenopus laevis... [more]
PROD2_RAT2.583e-1934.30Probable proline dehydrogenase 2 OS=Rattus norvegi... [more]
PROD2_HUMAN7.514e-1935.47Probable proline dehydrogenase 2 OS=Homo sapiens G... [more]
PROD_CAEEL2.186e-1831.48Proline dehydrogenase, mitochondrial OS=Caenorhabd... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32011G12EF RVDevelop1 Citrus clementina cDNA clone C32011G12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920692 ID=FC920692|Name=FC920692|organism=Citrus clementina|type=EST|length=662bp
GAGTGAGCGATTTGCTTATATGGCAACAAAGAGACCCTTCATTTAATCTC
CCGTGGAAGCTCAACAACTTCCCTCTTTTCTCGGATTGCAGCCCCTTATA
TCACACGTTGCAAAAACCTGAACCGTTGACATTACAAGAAGAAAATGAGC
TCCAATCAGCCCACCAAAGGCTACAAAAGTTGTGCCAAGAATGCTTAGAG
GCCAATGTGCCACTAACAGTCGATGCAGAGGACACATTTGTGCAGCCTGC
TATTGATTACTTGACATACAATGCAGCACTCTCGAACAACAAAGCCGGTA
AGCCGATCGTGTACAACACAATTCAGGCTTACTTGAAGGATGCCAAGGAA
AGATTGTTTCTTGCAACAGAAGCTGCTGAGAAAATGGGAGTGCCTATGGG
GTTTAAGCTTGTCAGGGGAGCTTATATGTCTAGTGAAAGTAAACTAGCTG
CGTCCTTGGGATTTGACTCTCCTATTCACAATAGCATTCAAGAGACTCAT
GCCTGTTACAACGATTGTGCTTCTTACATGCTGGAGAAGATTGCTGACGG
CTCCGGTGCTGTTGTTCTTGCTACCCATAATGTGGAATCAGGGCAACTAG
CCGCAGCAAAGGCGACTGATCTGGGGATCAAGGGGACCAGAAGCTGGAAT
TTGCACAGCTTT
back to top