FC920694

Overview
NameFC920694
Unique NameFC920694
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length649
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC920694 vs. ExPASy Swiss-Prot
Match: DCS2_GOSAR ((+)-delta-cadinene synthase isozyme XC14 OS=Gossypium arboreum PE=2 SV=1)

HSP 1 Score: 153.68 bits (387), Expect = 7.799e-37
Identity = 86/188 (45.74%), Postives = 120/188 (63.83%), Query Frame = 2
Query:   83 EVSASPAKVIQNAGKDSTRGSANFPPSIWGDHFFQYTCDSQETDDQNVK-HLELKKEIRRMLKA--ANKTSHTLELIDAIQRLGVSYHFENEIDEILGKMHKTYRDCDLCDNENDGLYYISLQFRLFRQNGYRISADVFNAFMGSDGKFMASLAKDVRGMLSFYEATHLRVHEENILDEALAFTSSHL 637
            +VS  P+    ++ KD  R  A+F PSIWGD F    C  +  D +  K H +LK+E+R+M+ A  AN T   L  ID++QRLGVSYHF  EI++ L  ++    D      END LY  SL+FRL R++G+ +S DVFN F    G F +S+  DVRG+L  Y+A++LRVH E+ILDEA++FT++HL
Sbjct:    4 QVSQMPSSSPLSSNKDEMRPKADFQPSIWGDLFLN--CPDKNIDAETEKRHQQLKEEVRKMIVAPMANSTQK-LAFIDSVQRLGVSYHFTKEIEDELENIYHNNNDA-----END-LYTTSLRFRLLREHGFNVSCDVFNKFKDEQGNFKSSVTSDVRGLLELYQASYLRVHGEDILDEAISFTTNHL 182          
BLAST of FC920694 vs. ExPASy Swiss-Prot
Match: DCS1_GOSAR ((+)-delta-cadinene synthase isozyme XC1 OS=Gossypium arboreum PE=1 SV=1)

HSP 1 Score: 153.68 bits (387), Expect = 7.799e-37
Identity = 86/188 (45.74%), Postives = 119/188 (63.30%), Query Frame = 2
Query:   83 EVSASPAKVIQNAGKDSTRGSANFPPSIWGDHFFQYTCDSQETDDQNVK-HLELKKEIRRMLKA--ANKTSHTLELIDAIQRLGVSYHFENEIDEILGKMHKTYRDCDLCDNENDGLYYISLQFRLFRQNGYRISADVFNAFMGSDGKFMASLAKDVRGMLSFYEATHLRVHEENILDEALAFTSSHL 637
            +VS  P+    ++ KD  R  A+F PSIWGD F    C  +  D +  K H +LK+E+R+M+ A  AN T   L  ID++QRLGVSYHF  EI++ L  ++    D      END LY  S++FRL R++GY +S DVFN F    G F +S+  DVRG+L  Y+A++LRVH E+ILDEA++FT+ HL
Sbjct:    4 QVSQMPSSSPLSSNKDEMRPKADFQPSIWGDLFLN--CPDKNIDAETEKRHQQLKEEVRKMIVAPMANSTQK-LAFIDSVQRLGVSYHFTKEIEDELENIYHNNNDA-----END-LYTTSIRFRLLREHGYNVSCDVFNKFKDEQGNFKSSVTSDVRGLLELYQASYLRVHGEDILDEAISFTTHHL 182          
BLAST of FC920694 vs. ExPASy Swiss-Prot
Match: DCS4_GOSAR ((+)-delta-cadinene synthase isozyme C2 OS=Gossypium arboreum GN=CAD1-C2 PE=2 SV=1)

HSP 1 Score: 152.91 bits (385), Expect = 1.330e-36
Identity = 86/188 (45.74%), Postives = 119/188 (63.30%), Query Frame = 2
Query:   83 EVSASPAKVIQNAGKDSTRGSANFPPSIWGDHFFQYTCDSQETDDQNVK-HLELKKEIRRMLKA--ANKTSHTLELIDAIQRLGVSYHFENEIDEILGKMHKTYRDCDLCDNENDGLYYISLQFRLFRQNGYRISADVFNAFMGSDGKFMASLAKDVRGMLSFYEATHLRVHEENILDEALAFTSSHL 637
            +VS  P+    ++ KD  R  A+F PSIWGD F    C  +  D    K H +LK+E+R+M+ A  AN T   L  ID++QRLGVSYHF  EI++ L  ++    D      END LY  SL+FRL R++GY +S DVFN F    G F +S+  DV+G+L  Y+A++LRVH E+ILDEA++FT++HL
Sbjct:    4 QVSQMPSSSPLSSNKDEIRPKADFQPSIWGDFFLN--CPDKNIDAGTEKRHQQLKEEVRKMIVAPMANSTQK-LAFIDSVQRLGVSYHFTKEIEDELENIYHNNNDA-----END-LYTTSLRFRLLREHGYNVSCDVFNKFKDEQGNFKSSVTSDVQGLLELYQASYLRVHGEDILDEAISFTTNHL 182          
BLAST of FC920694 vs. ExPASy Swiss-Prot
Match: 5EAS_TOBAC (Aristolochene synthase OS=Nicotiana tabacum GN=EAS3 PE=1 SV=3)

HSP 1 Score: 152.91 bits (385), Expect = 1.330e-36
Identity = 80/182 (43.96%), Postives = 118/182 (64.84%), Query Frame = 2
Query:  110 IQNAGKDSTRGSANFPPSIWGDHFFQYTCDSQETDDQNVKHLELKKEIRRMLKAAN-KTSHTLELIDAIQRLGVSYHFENEIDEILGKMHKTYRDC-DLCDNENDGLYYISLQFRLFRQNGYRISADVFNAFMGSDGKFMASLAKDVRGMLSFYEATHLRVHEENILDEALAFTSSHLESVA 649
            + N  ++  R  A+F PS+WGD F  ++  +Q  +    +   LK++ R ML A   K + TL LID I+RLG+SYHFE EID+IL +++    +C DLC +        +LQFRL RQ+G+ IS ++F+ F   +GKF  SLA DV G+L+ YEA+H+R H ++IL++ALAF++ HLES A
Sbjct:    6 VANYEEEIVRPVADFSPSLWGDQFLSFSIKNQVAEKYAKEIEALKEQTRNMLLATGMKLADTLNLIDTIERLGISYHFEKEIDDILDQIYNQNSNCNDLCTS--------ALQFRLLRQHGFNISPEIFSKFQDENGKFKESLASDVLGLLNLYEASHVRTHADDILEDALAFSTIHLESAA 179          
BLAST of FC920694 vs. ExPASy Swiss-Prot
Match: DCS1_GOSHI ((+)-delta-cadinene synthase OS=Gossypium hirsutum GN=CDN1 PE=1 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 2.269e-36
Identity = 86/188 (45.74%), Postives = 119/188 (63.30%), Query Frame = 2
Query:   83 EVSASPAKVIQNAGKDSTRGSANFPPSIWGDHFFQYTCDSQETDDQNVK-HLELKKEIRRMLKA--ANKTSHTLELIDAIQRLGVSYHFENEIDEILGKMHKTYRDCDLCDNENDGLYYISLQFRLFRQNGYRISADVFNAFMGSDGKFMASLAKDVRGMLSFYEATHLRVHEENILDEALAFTSSHL 637
            +VS  P+    ++ KD  R  A+F PSIWGD F    C  +  D +  K H +LK+E+R+M+ A  AN T   L  ID++Q LGVSYHF  EI++ L  ++    D      END LY  SL+FRL R++G+ +S DVFN F    G F +S+  DVRG+L  Y+A++LRVH E+ILDEA++FTS+HL
Sbjct:    4 QVSQMPSSSPLSSNKDEMRPKADFQPSIWGDFFLN--CPDKNIDAETQKRHQQLKEEVRKMIVAPMANSTLK-LAFIDSVQGLGVSYHFTKEIEDELENIYHNNNDA-----END-LYTTSLRFRLLREHGFHVSCDVFNKFKDEQGNFKSSVTSDVRGLLELYQASYLRVHGEDILDEAISFTSNHL 182          
BLAST of FC920694 vs. ExPASy Swiss-Prot
Match: CASS_RICCO (Casbene synthase, chloroplastic OS=Ricinus communis PE=1 SV=1)

HSP 1 Score: 149.828 bits (377), Expect = 1.126e-35
Identity = 78/172 (45.35%), Postives = 116/172 (67.44%), Query Frame = 2
Query:  137 RGSANFPPSIWGDHFFQYTCDSQETDDQNVKHLELKKEIRRMLKAANKTS-HTLELIDAIQRLGVSYHFENEIDEILGKMHKTYRDCDLCDNENDGLYYISLQFRLFRQNGYRISADVFNAFMGSDGKFMASLAKDVRGMLSFYEATHLRVHEENILDEALAFTSSHLESVA 649
            R  A FPP++WG+ F   T +  E +  + + + LKK+++ +L ++   S  T+ LID + RLGVSYHFEN+I+E+L K+  +  D  L D +   LY  ++ FR+FRQ+G+++S+DVF+ F  SDGKF  SL  D +GMLS +EA+HL VH E+IL+EA AFT  +L+S A
Sbjct:   64 RPLAYFPPTVWGNRFASLTFNPSEFESYDERVIVLKKKVKDILISSTSDSVETVILIDLLCRLGVSYHFENDIEELLSKIFNSQPD--LVDEKECDLYTAAIVFRVFRQHGFKMSSDVFSKFKDSDGKFKESLRGDAKGMLSLFEASHLSVHGEDILEEAFAFTKDYLQSSA 233          
BLAST of FC920694 vs. ExPASy Swiss-Prot
Match: DCS3_GOSAR ((+)-delta-cadinene synthase isozyme A OS=Gossypium arboreum GN=CAD1-A PE=2 SV=1)

HSP 1 Score: 140.198 bits (352), Expect = 8.923e-33
Identity = 80/187 (42.78%), Postives = 117/187 (62.57%), Query Frame = 2
Query:   83 EVSASPAKVIQNAGKDSTRGSANFPPSIWGDHFFQYTCDSQETDDQN-VKHLELKKEIRRML-KAANKTSHTLELIDAIQRLGVSYHFENEIDEILGKMHKTYRDCDLCDNENDGLYYISLQFRLFRQNGYRISADVFNAFMGSDGKFMASLAKDVRGMLSFYEATHLRVHEENILDEALAFTSSHL 637
            +V ASP   I +      R  A+F P IWGD F    C   + D    +++ ELK ++R+M+ +  + ++  L  IDA+QRLGVSYHFE EI++   ++   YRD +  D + D LY  +L+FRL R++G+ IS D FN F    G F ASL  DV+G+L  YEA+++RVH E+ILDEA++FT++ L
Sbjct:    7 QVLASPHPAISS----ENRPKADFHPGIWGDMFI--ICPDTDIDAATELQYEELKAQVRKMIMEPVDDSNQKLPFIDAVQRLGVSYHFEKEIED---ELENIYRDTNNNDADTD-LYTTALRFRLLREHGFDISCDAFNKFKDEAGNFKASLTSDVQGLLELYEASYMRVHGEDILDEAISFTTAQL 183          
BLAST of FC920694 vs. ExPASy Swiss-Prot
Match: AMS1_ARTAN (Amorpha-4,11-diene synthase OS=Artemisia annua GN=AMS1 PE=1 SV=2)

HSP 1 Score: 136.732 bits (343), Expect = 9.866e-32
Identity = 81/171 (47.37%), Postives = 104/171 (60.82%), Query Frame = 2
Query:  137 RGSANFPPSIWGDHFFQYTCDSQETDDQNVKHLELKKEIRRMLKAA----NKTSHTLELIDAIQRLGVSYHFENEIDEILGKMHKTYRDCDLCDNENDGLYYISLQFRLFRQNGYRISADVFNAFMGSDGKFMASLAKDVRGMLSFYEATHLRVHEENILDEALAFTSSHL 637
            R  ANFPPSIWGD F  Y    ++  +Q V   +LKKE+R++LK A     K ++ L+LID IQRLG+ YHFE EID  L  +++TY D    D         SL FRL R+ GY ++ DVFN +   +G F  SLA DV G+L  YEAT +RV  E IL++AL FT S L
Sbjct:   10 RPIANFPPSIWGDQFLIYEKQVEQGVEQIVN--DLKKEVRQLLKEALDIPMKHANLLKLIDEIQRLGIPYHFEREIDHALQCIYETYGDNWNGDRS-------SLWFRLMRKQGYYVTCDVFNNYKDKNGAFKQSLANDVEGLLELYEATSMRVPGEIILEDALGFTRSRL 171          
BLAST of FC920694 vs. ExPASy Swiss-Prot
Match: ECS1_ARTAN (Epi-cedrol synthase OS=Artemisia annua GN=ECS1 PE=1 SV=1)

HSP 1 Score: 135.961 bits (341), Expect = 1.683e-31
Identity = 73/177 (41.24%), Postives = 107/177 (60.45%), Query Frame = 2
Query:  125 KDSTRGSANFPPSIWGDHFFQYTCDSQETDDQNVKHL--ELKKEIRRMLKAANKTSHTLELIDAIQRLGVSYHFENEIDEILGKMHKTYRDCDLCDNENDGLYYISLQFRLFRQNGYRISADVFNAFMGSDGKFMASLAKDVRGMLSFYEATHLRVHEENILDEALAFTSSHLESVA 649
            +D  R +ANFP  IWGD F  Y  D QE  +Q +K L  E+K E+   L +  + +  L+ IDAI+RLG++Y+FE EI+++   M+  Y D     N        SL FRL RQ+G+ +S+D+F+ +   +G+F  SL KDV G+L  YEA ++ V  E ILD+AL FT + L+ +A
Sbjct:    6 EDVIRPNANFPSEIWGDQFLAYDQDEQEGVEQVIKDLKEEVKSELLTALNSPTQHTELLKFIDAIERLGIAYYFEEEINQVFQHMYTAYGDKWTGGNT-------SLWFRLMRQHGFFVSSDIFSTYKDKEGRFKESLEKDVHGLLELYEAAYMFVPGEGILDDALVFTRTCLDEIA 175          
BLAST of FC920694 vs. ExPASy Swiss-Prot
Match: MYRS_QUEIL (Myrcene synthase, chloroplastic OS=Quercus ilex PE=1 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 2.971e-28
Identity = 71/171 (41.52%), Postives = 97/171 (56.73%), Query Frame = 2
Query:  128 DSTRGSANFPPSIWGDHFFQYTCDSQETDDQNVKHLELKKEIRRMLKAANKTSHTLELIDAIQRLGVSYHFENEIDEILGKMHKTYRDCDLCDNENDGLYYISLQFRLFRQNGYRISADVFNAFMGSDGKFMASLAKDVRGMLSFYEATHLRVHEENILDEALAFTSSHLE 640
            D  R SAN+ PSIW   + +        +    +   LK+++R ML         LELI+ +QRLG+SYHFE EI  IL  ++      D    EN  LY  +L+FRL RQ+GY +S +VFN+F    G F A L +D +GMLS YEA+   +  ENIL+EA  F++ HLE
Sbjct:   54 DILRRSANYQPSIWNHDYIESLRIEYVGETCTRQINVLKEQVRMMLHKVVNPLEQLELIEILQRLGLSYHFEEEIKRILDGVYNNDHGGDTWKAEN--LYATALKFRLLRQHGYSVSQEVFNSFKDERGSFKACLCEDTKGMLSLYEASFFLIEGENILEEARDFSTKHLE 222          
The following BLAST results are available for this feature:
BLAST of FC920694 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 32
Match NameE-valueIdentityDescription
DCS2_GOSAR7.799e-3745.74(+)-delta-cadinene synthase isozyme XC14 OS=Gossyp... [more]
DCS1_GOSAR7.799e-3745.74(+)-delta-cadinene synthase isozyme XC1 OS=Gossypi... [more]
DCS4_GOSAR1.330e-3645.74(+)-delta-cadinene synthase isozyme C2 OS=Gossypiu... [more]
5EAS_TOBAC1.330e-3643.96Aristolochene synthase OS=Nicotiana tabacum GN=EAS... [more]
DCS1_GOSHI2.269e-3645.74(+)-delta-cadinene synthase OS=Gossypium hirsutum ... [more]
CASS_RICCO1.126e-3545.35Casbene synthase, chloroplastic OS=Ricinus communi... [more]
DCS3_GOSAR8.923e-3342.78(+)-delta-cadinene synthase isozyme A OS=Gossypium... [more]
AMS1_ARTAN9.866e-3247.37Amorpha-4,11-diene synthase OS=Artemisia annua GN=... [more]
ECS1_ARTAN1.683e-3141.24Epi-cedrol synthase OS=Artemisia annua GN=ECS1 PE=... [more]
MYRS_QUEIL2.971e-2841.52Myrcene synthase, chloroplastic OS=Quercus ilex PE... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32011H02EF RVDevelop1 Citrus clementina cDNA clone C32011H02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920694 ID=FC920694|Name=FC920694|organism=Citrus clementina|type=EST|length=649bp
GGAATCAGCAAAGCTTTGGCTACCTTTTTTTTTCTCAAGACTCAATAGCC
TTCAGAAGTAATAGAAATTAAGTATGTCTTTAGAAGTTTCAGCCTCTCCT
GCTAAGGTCATCCAAAATGCTGGAAAAGATTCTACTCGTGGTTCTGCAAA
TTTTCCTCCAAGCATTTGGGGAGATCATTTCTTTCAATATACTTGTGACT
CCCAGGAAACTGATGATCAAAATGTAAAGCATCTAGAGCTGAAGAAAGAA
ATTAGAAGAATGCTGAAAGCTGCTAACAAGACTTCACATACACTTGAATT
GATAGATGCAATTCAGCGGTTAGGAGTGTCGTACCATTTTGAAAATGAGA
TTGATGAAATCTTGGGAAAGATGCACAAGACTTATCGAGACTGTGATCTT
TGTGATAATGAAAATGATGGGCTCTATTATATCTCTCTTCAGTTTCGATT
GTTCAGACAAAATGGCTATAGAATTTCCGCTGATGTTTTCAATGCGTTCA
TGGGAAGCGATGGGAAATTTATGGCATCTCTTGCAAAAGATGTTCGAGGA
ATGTTAAGCTTCTATGAAGCTACACATCTCAGGGTTCATGAAGAAAATAT
ACTAGATGAAGCGCTTGCTTTCACCTCTAGTCACCTTGAGTCAGTGGCA
back to top