FC920925

Overview
NameFC920925
Unique NameFC920925
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length698
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14215 contig Ccv1_Contig14215:1..698. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920925 vs. ExPASy Swiss-Prot
Match: GOX_SPIOL (Peroxisomal (S)-2-hydroxy-acid oxidase OS=Spinacia oleracea PE=1 SV=1)

HSP 1 Score: 217.624 bits (553), Expect = 5.011e-56
Identity = 106/170 (62.35%), Postives = 137/170 (80.59%), Query Frame = 1
Query:  175 EPVNLNEFQELARLALPKMYYDFYAGGAEDEHTLKENVEAFHRITFRPRILVDVSRIDLSTTILDYKISAPIIIAPTAFHKLANPEGEVATARAAASCNTIMVLSFTSSSTIEEVAASSNAVRFYQLYVFKKRDITATLVQRAERNGFKALVLTADTPRLGRREADIKNK 684
            E  N+NE++ +A+  LPKM YD+YA GAED+ TL EN  AF RI FRPRIL+DV+ ID++TTIL +KIS PI+IAPTA  K+A+PEGE ATARAA++  TIM LS  ++S++EEVA++   +RF+QLYV+K R++ A LV+RAER GFKA+ LT DTPRLGRREADIKN+
Sbjct:    2 EITNVNEYEAIAKQKLPKMVYDYYASGAEDQWTLAENRNAFSRILFRPRILIDVTNIDMTTTILGFKISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGPGIRFFQLYVYKDRNVVAQLVRRAERAGFKAIALTVDTPRLGRREADIKNR 171          
BLAST of FC920925 vs. ExPASy Swiss-Prot
Match: GOX2_ARATH (Probable peroxisomal (S)-2-hydroxy-acid oxidase 2 OS=Arabidopsis thaliana GN=At3g14420 PE=1 SV=1)

HSP 1 Score: 212.231 bits (539), Expect = 2.105e-54
Identity = 101/170 (59.41%), Postives = 136/170 (80.00%), Query Frame = 1
Query:  175 EPVNLNEFQELARLALPKMYYDFYAGGAEDEHTLKENVEAFHRITFRPRILVDVSRIDLSTTILDYKISAPIIIAPTAFHKLANPEGEVATARAAASCNTIMVLSFTSSSTIEEVAASSNAVRFYQLYVFKKRDITATLVQRAERNGFKALVLTADTPRLGRREADIKNK 684
            E  N+ E+  +A+  LPKM YD+YA GAED+ TL+EN  AF RI FRPRIL+DVS+ID++TT+L +KIS PI++APTA  K+A+P+GE ATARAA++  TIM LS  ++S++EEVA++   +RF+QLYV+K R++   LV+RAER GFKA+ LT DTPRLGRRE+DIKN+
Sbjct:    2 EITNVTEYDAIAKQKLPKMVYDYYASGAEDQWTLQENRNAFARILFRPRILIDVSKIDMTTTVLGFKISMPIMVAPTAMQKMAHPDGEYATARAASAAGTIMTLSSWATSSVEEVASTGPGIRFFQLYVYKNRNVVEQLVRRAERAGFKAIALTVDTPRLGRRESDIKNR 171          
BLAST of FC920925 vs. ExPASy Swiss-Prot
Match: GOX1_ARATH (Probable peroxisomal (S)-2-hydroxy-acid oxidase 1 OS=Arabidopsis thaliana GN=At3g14415 PE=1 SV=1)

HSP 1 Score: 211.846 bits (538), Expect = 2.750e-54
Identity = 100/170 (58.82%), Postives = 136/170 (80.00%), Query Frame = 1
Query:  175 EPVNLNEFQELARLALPKMYYDFYAGGAEDEHTLKENVEAFHRITFRPRILVDVSRIDLSTTILDYKISAPIIIAPTAFHKLANPEGEVATARAAASCNTIMVLSFTSSSTIEEVAASSNAVRFYQLYVFKKRDITATLVQRAERNGFKALVLTADTPRLGRREADIKNK 684
            E  N+ E+  +A+  LPKM YD+YA GAED+ TL+EN  AF RI FRPRIL+DV++ID++TT+L +KIS PI++APTAF K+A+P+GE ATARAA++  TIM LS  ++S++EEVA++   +RF+QLYV+K R +   LV+RAE+ GFKA+ LT DTPRLGRRE+DIKN+
Sbjct:    2 EITNVTEYDAIAKAKLPKMVYDYYASGAEDQWTLQENRNAFARILFRPRILIDVNKIDMATTVLGFKISMPIMVAPTAFQKMAHPDGEYATARAASAAGTIMTLSSWATSSVEEVASTGPGIRFFQLYVYKNRKVVEQLVRRAEKAGFKAIALTVDTPRLGRRESDIKNR 171          
BLAST of FC920925 vs. ExPASy Swiss-Prot
Match: HAOX_DICDI (Hydroxyacid oxidase OS=Dictyostelium discoideum GN=haox PE=3 SV=1)

HSP 1 Score: 154.451 bits (389), Expect = 5.210e-37
Identity = 84/182 (46.15%), Postives = 120/182 (65.93%), Query Frame = 1
Query:  142 NSYSNRFHMAAEP-VNLNEFQELARLALPKMYYDFYAGGAEDEHTLKENVEAFHRITFRPRILVDVSRIDLSTTILDYKISAPIIIAPTAFHKLANPEGEVATARAAASCNTIMVLSFTSSSTIEEVAASSNA-VRFYQLYVFKKRDITATLVQRAERNGFKALVLTADTPRLGRREADIKN 681
            N +SN+     +  V+++E  E A+  LPKM YD+YA G+ D+ TL EN  AF RI   PR LVDVS+++  T I    IS PI+IAP A  ++A+  GE+ T  A+   NTIM LS  S++++E++++++N    ++QLYVFK R ++  LV+RAE  G+ ALVLT DTP LG+R AD KN
Sbjct:   18 NQFSNKKTNRLDSFVSVSELHEEAKRLLPKMAYDYYASGSNDQITLAENENAFSRIKLVPRSLVDVSKVNTKTRIFGRDISTPILIAPWAMQRMASQRGELDTVEASKEFNTIMTLSSLSTTSVEDLSSATNGNPGWFQLYVFKDRKVSEELVKRAESIGYSALVLTVDTPFLGKRTADFKN 199          
BLAST of FC920925 vs. ExPASy Swiss-Prot
Match: HAOX1_HUMAN (Hydroxyacid oxidase 1 OS=Homo sapiens GN=HAO1 PE=1 SV=1)

HSP 1 Score: 152.525 bits (384), Expect = 1.980e-36
Identity = 75/167 (44.91%), Postives = 116/167 (69.46%), Query Frame = 1
Query:  187 LNEFQELARLALPKMYYDFYAGGAEDEHTLKENVEAFHRITFRPRILVDVSRIDLSTTILDYKISAPIIIAPTAFHKLANPEGEVATARAAASCNTIMVLSFTSSSTIEEVA-ASSNAVRFYQLYVFKKRDITATLVQRAERNGFKALVLTADTPRLGRREADIKNK 684
            +N++++ A+  LPK  YD+Y  GA DE TL +N+ AF R    PR+L +V+  DLST++L  ++S PI +  TA  ++A+ +GE+AT RA  S  T M+LS  ++S+IEEVA A   A+R+ QLY++K R++T  LV++AE+ G+KA+ +T DTP LG R  D++N+
Sbjct:    8 INDYEQHAKSVLPKSIYDYYRSGANDEETLADNIAAFSRWKLYPRMLRNVAETDLSTSVLGQRVSMPICVGATAMQRMAHVDGELATVRACQSLGTGMMLSSWATSSIEEVAEAGPEALRWLQLYIYKDREVTKKLVRQAEKMGYKAIFVTVDTPYLGNRLDDVRNR 174          
BLAST of FC920925 vs. ExPASy Swiss-Prot
Match: HAOX2_BOVIN (Hydroxyacid oxidase 2 OS=Bos taurus GN=HAO2 PE=2 SV=1)

HSP 1 Score: 150.984 bits (380), Expect = 5.760e-36
Identity = 81/169 (47.93%), Postives = 113/169 (66.86%), Query Frame = 1
Query:  181 VNLNEFQELARLALPKMYYDFYAGGAEDEHTLKENVEAFHRITFRPRILVDVSRIDLSTTILDYKISAPIIIAPTAFHKLANPEGEVATARAAASCNTIMVLSFTSSSTIEE-VAASSNAVRFYQLYVFKKRDITATLVQRAERNGFKALVLTADTPRLGRREADIKNK 684
            V L +F+E AR  L K  +DF  GGA+D  T  EN+ AF +I  RPR L DVS++D+ TTI   +ISAPI IAPT FH+LA P+GE++TARAA + +   + S  +S ++E+ VAA+   +R++QLYV   R I   ++Q+ E  GFKALV+T D P++G R  DI N+
Sbjct:    4 VCLTDFREHAREHLSKSTWDFIEGGADDCCTRDENMAAFKKIRLRPRYLKDVSKVDMRTTIQGAEISAPICIAPTGFHRLAWPDGEMSTARAAQAASICYITSTYASCSLEDIVAAAPRGLRWFQLYVHPNRQINKQMIQKVESLGFKALVITVDVPKVGNRRNDITNQ 172          
BLAST of FC920925 vs. ExPASy Swiss-Prot
Match: HAOX1_MOUSE (Hydroxyacid oxidase 1 OS=Mus musculus GN=Hao1 PE=2 SV=1)

HSP 1 Score: 145.976 bits (367), Expect = 1.853e-34
Identity = 73/169 (43.20%), Postives = 116/169 (68.64%), Query Frame = 1
Query:  181 VNLNEFQELARLALPKMYYDFYAGGAEDEHTLKENVEAFHRITFRPRILVDVSRIDLSTTILDYKISAPIIIAPTAFHKLANPEGEVATARAAASCNTIMVLSFTSSSTIEEVA-ASSNAVRFYQLYVFKKRDITATLVQRAERNGFKALVLTADTPRLGRREADIKNK 684
            V ++++++  R  L K  YD+Y  GA D+ TL +N++AF R    PR+L +V+ IDLST++L  ++S PI +  TA   +A+ +GE+AT RA  +  T M+LS  ++S+IEEVA A   A+R+ QLY++K R+I+  +V+RAE+ G+KA+ +T DTP LG R  D++N+
Sbjct:    6 VCISDYEQHVRSVLQKSVYDYYRSGANDQETLADNIQAFSRWKLYPRMLRNVADIDLSTSVLGQRVSMPICVGATAMQCMAHVDGELATVRACQTMGTGMMLSSWATSSIEEVAEAGPEALRWMQLYIYKDREISRQIVKRAEKQGYKAIFVTVDTPYLGNRIDDVRNR 174          
BLAST of FC920925 vs. ExPASy Swiss-Prot
Match: HAOX2_RAT (Hydroxyacid oxidase 2 OS=Rattus norvegicus GN=Hao2 PE=1 SV=2)

HSP 1 Score: 143.28 bits (360), Expect = 1.201e-33
Identity = 81/169 (47.93%), Postives = 108/169 (63.91%), Query Frame = 1
Query:  181 VNLNEFQELARLALPKMYYDFYAGGAEDEHTLKENVEAFHRITFRPRILVDVSRIDLSTTILDYKISAPIIIAPTAFHKLANPEGEVATARAAASCNTIMVLSFTSSSTIEE-VAASSNAVRFYQLYVFKKRDITATLVQRAERNGFKALVLTADTPRLGRREADIKNK 684
            V L +F+  A+  L K  +DF  G A+D  T  EN+ AF RI  RPR L D+S++D  TTI   +ISAPI I+PTAFH +A P+GE +TARAA   N   V+S  +S ++E+ VAA+    R++QLY+    D    +VQRAE  GFKALV+T DTP LG R  D +N+
Sbjct:    4 VCLADFKAHAQKQLSKTSWDFIEGEADDGITYSENIAAFKRIRLRPRYLRDMSKVDTRTTIQGQEISAPICISPTAFHSIAWPDGEKSTARAAQEANICYVISSYASYSLEDIVAAAPEGFRWFQLYMKSDWDFNKQMVQRAEALGFKALVITIDTPVLGNRRRDKRNQ 172          
BLAST of FC920925 vs. ExPASy Swiss-Prot
Match: HAOX2_HUMAN (Hydroxyacid oxidase 2 OS=Homo sapiens GN=HAO2 PE=2 SV=1)

HSP 1 Score: 141.354 bits (355), Expect = 4.564e-33
Identity = 80/169 (47.34%), Postives = 104/169 (61.54%), Query Frame = 1
Query:  181 VNLNEFQELARLALPKMYYDFYAGGAEDEHTLKENVEAFHRITFRPRILVDVSRIDLSTTILDYKISAPIIIAPTAFHKLANPEGEVATARAAASCNTIMVLSFTSSSTIEE-VAASSNAVRFYQLYVFKKRDITATLVQRAERNGFKALVLTADTPRLGRREADIKNK 684
            V L +FQ  AR  L K   DF  GGA+D  T  +N+ AF RI  RPR L DVS +D  TTI   +ISAPI IAPT FH L  P+GE++TARAA +     + S  +S ++E+ V A+   +R++QLYV     +   L+QR E  GFKALV+T DTP  G R  DI+N+
Sbjct:    4 VCLTDFQAHAREQLSKSTRDFIEGGADDSITRDDNIAAFKRIRLRPRYLRDVSEVDTRTTIQGEEISAPICIAPTGFHCLVWPDGEMSTARAAQAAGICYITSTFASCSLEDIVIAAPEGLRWFQLYVHPDLQLNKQLIQRVESLGFKALVITLDTPVCGNRRHDIRNQ 172          
BLAST of FC920925 vs. ExPASy Swiss-Prot
Match: CYB2_HANAN (Cytochrome b2, mitochondrial OS=Hansenula anomala GN=CYB2 PE=1 SV=2)

HSP 1 Score: 140.969 bits (354), Expect = 5.961e-33
Identity = 74/173 (42.77%), Postives = 106/173 (61.27%), Query Frame = 1
Query:  172 AEPVNLNEFQELARLALPKMYYDFYAGGAEDEHTLKENVEAFHRITFRPRILVDVSRIDLSTTILDYKISAPIIIAPTAFHKLANPEGEVATARAAASCNTIMVLSFTSSSTIEEVAAS--SNAVRFYQLYVFKKRDITATLVQRAERNGFKALVLTADTPRLGRREADIKNK 684
            ++ +NL++F+ +AR  LP     +Y   A+DE TL+EN  A+HRI F P+IL+DV  +D+ST     K SAP  I+ TA  KL +PEGEVA A+ A   + + ++S  +S + +E+A +      ++YQLYV   R IT   V+ AE  G K L +T D P LGRRE D+K K
Sbjct:  185 SQMINLHDFETIARQILPPPALAYYCSAADDEVTLRENHNAYHRIFFNPKILIDVKDVDISTEFFGEKTSAPFYISATALAKLGHPEGEVAIAKGAGREDVVQMISTLASCSFDEIADARIPGQQQWYQLYVNADRSITEKAVRHAEERGMKGLFITVDAPSLGRREKDMKMK 357          
The following BLAST results are available for this feature:
BLAST of FC920925 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 127
Match NameE-valueIdentityDescription
GOX_SPIOL5.011e-5662.35Peroxisomal (S)-2-hydroxy-acid oxidase OS=Spinacia... [more]
GOX2_ARATH2.105e-5459.41Probable peroxisomal (S)-2-hydroxy-acid oxidase 2 ... [more]
GOX1_ARATH2.750e-5458.82Probable peroxisomal (S)-2-hydroxy-acid oxidase 1 ... [more]
HAOX_DICDI5.210e-3746.15Hydroxyacid oxidase OS=Dictyostelium discoideum GN... [more]
HAOX1_HUMAN1.980e-3644.91Hydroxyacid oxidase 1 OS=Homo sapiens GN=HAO1 PE=1... [more]
HAOX2_BOVIN5.760e-3647.93Hydroxyacid oxidase 2 OS=Bos taurus GN=HAO2 PE=2 S... [more]
HAOX1_MOUSE1.853e-3443.20Hydroxyacid oxidase 1 OS=Mus musculus GN=Hao1 PE=2... [more]
HAOX2_RAT1.201e-3347.93Hydroxyacid oxidase 2 OS=Rattus norvegicus GN=Hao2... [more]
HAOX2_HUMAN4.564e-3347.34Hydroxyacid oxidase 2 OS=Homo sapiens GN=HAO2 PE=2... [more]
CYB2_HANAN5.961e-3342.77Cytochrome b2, mitochondrial OS=Hansenula anomala ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32014H05EF RVDevelop1 Citrus clementina cDNA clone C32014H05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920925 ID=FC920925|Name=FC920925|organism=Citrus clementina|type=EST|length=698bp
ACTAATCCTTTATACGCTTCTTGACTTTAACTCTGCCCCCGACTCACTGT
TGTAATCTGCTTCACGATCGACCTTCATCAGTTGAAATTTTTAGTCATTC
GGGTTCATTTCTTTACAAAATTCTATTGTTTAAGTTTGATTAATAGTTAT
TCGAATCGGTTTCACATGGCAGCTGAACCTGTTAATTTGAATGAGTTCCA
AGAATTGGCAAGGCTGGCCCTTCCAAAAATGTATTATGATTTCTACGCTG
GTGGAGCAGAAGATGAACATACCCTAAAAGAGAATGTGGAAGCCTTTCAT
AGAATTACGTTTCGGCCAAGAATTCTTGTCGATGTCAGCAGAATAGATTT
ATCGACTACTATACTTGATTACAAAATCTCGGCTCCCATTATCATTGCTC
CAACGGCTTTCCATAAGCTTGCAAACCCTGAAGGAGAAGTAGCCACAGCC
AGAGCAGCAGCTTCATGTAACACCATAATGGTTTTATCCTTCACATCTAG
CAGCACCATAGAGGAGGTTGCGGCCAGCTCCAATGCTGTTCGCTTCTATC
AATTATATGTATTCAAGAAACGAGATATAACAGCTACTCTAGTGCAGAGA
GCTGAAAGGAATGGTTTTAAGGCTCTTGTCCTAACTGCTGATACTCCAAG
ACTTGGTAGAAGGGAGGCAGATATAAAGAACAAATGATTACACGCCGT
back to top