FC920928

Overview
NameFC920928
Unique NameFC920928
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length661
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig90 contig Ccv1_Contig90:166..826. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920928 vs. ExPASy Swiss-Prot
Match: CAHC_ARATH (Carbonic anhydrase, chloroplastic OS=Arabidopsis thaliana GN=CA1 PE=1 SV=2)

HSP 1 Score: 261.151 bits (666), Expect = 3.521e-69
Identity = 132/173 (76.30%), Postives = 141/173 (81.50%), Query Frame = 3
Query:  138 VAAAKVEQITAQLQT--PSDTKAFDSVERIKEGFIHFKREKYEKNPALYSELAKGQSPKYMVFACSDSRVCPSHVLDFQPGEAFVVRNVANIVPPYDQTKXXXXXXXXXXXXLHLKVSNIVVIGHSACGGIKGLMSFTFDGNNSTDFIEDWVKIGIPAKSKVFTEHGDKPFGD 650
            VAAAKVEQITA LQT   SD KAFD VE IK+GFI FK+EKYE NPALY ELAKGQSPKYMVFACSDSRVCPSHVLDFQPG+AFVVRN+AN+VPP+D+ K            LHLKV NIVVIGHSACGGIKGLMSF  DGNNSTDFIEDWVKI +PAKSKV +E GD  F D
Sbjct:  103 VAAAKVEQITAALQTGTSSDKKAFDPVETIKQGFIKFKKEKYETNPALYGELAKGQSPKYMVFACSDSRVCPSHVLDFQPGDAFVVRNIANMVPPFDKVKYGGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPLDGNNSTDFIEDWVKICLPAKSKVISELGDSAFED 275          
BLAST of FC920928 vs. ExPASy Swiss-Prot
Match: CAHC_TOBAC (Carbonic anhydrase, chloroplastic OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 256.144 bits (653), Expect = 1.133e-67
Identity = 129/201 (64.18%), Postives = 147/201 (73.13%), Query Frame = 3
Query:   48 INREDMANYSYXXXXXXXXXXXXXXXXXXPVAAAKVEQITAQLQTPSDTKAFDSVERIKEGFIHFKREKYEKNPALYSELAKGQSPKYMVFACSDSRVCPSHVLDFQPGEAFVVRNVANIVPPYDQTKXXXXXXXXXXXXLHLKVSNIVVIGHSACGGIKGLMSFTFDGNNSTDFIEDWVKIGIPAKSKVFTEHGDKPFGD 650
            I RE+MA  SY                  P+AAA+V+QITA+LQ+   +K FD VE +K GFIHFK EKYEKNPALY EL+KGQSPK+MVFACSDSRVCPSHVL+FQPGEAFVVRN+AN+VP YD+T+            LHLKV NIVVIGHSACGGIKGLMS   DG+ ST FIEDWVKIG+PAK+KV  EH DK F D
Sbjct:   60 ILREEMAKESYEQAIAALEKLLSEKGELGPIAAARVDQITAELQSSDGSKPFDPVEHMKAGFIHFKTEKYEKNPALYGELSKGQSPKFMVFACSDSRVCPSHVLNFQPGEAFVVRNIANMVPAYDKTRYSGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSLPADGSESTAFIEDWVKIGLPAKAKVQGEHVDKCFAD 260          
BLAST of FC920928 vs. ExPASy Swiss-Prot
Match: CAHC_PEA (Carbonic anhydrase, chloroplastic OS=Pisum sativum PE=1 SV=1)

HSP 1 Score: 253.832 bits (647), Expect = 5.621e-67
Identity = 125/173 (72.25%), Postives = 139/173 (80.35%), Query Frame = 3
Query:  141 AAAKVEQITAQLQTPSDTKAF---DSVERIKEGFIHFKREKYEKNPALYSELAKGQSPKYMVFACSDSRVCPSHVLDFQPGEAFVVRNVANIVPPYDQTKXXXXXXXXXXXXLHLKVSNIVVIGHSACGGIKGLMSFTFDGNNSTDFIEDWVKIGIPAKSKVFTEHGDKPFGD 650
            AA KVEQITAQL T S +      ++ ERIK GF+HFK+EKY+KNPALY ELAKGQSP +MVFACSDSRVCPSHVLDFQPGEAFVVRNVAN+VPPYDQ K            LHLKVSNIVVIGHSACGGIKGL+SF FDG  STDFIE+WVKIG+PAK+KV  +HGD PF +
Sbjct:   95 AAEKVEQITAQLGTTSSSDGIPKSEASERIKTGFLHFKKEKYDKNPALYGELAKGQSPPFMVFACSDSRVCPSHVLDFQPGEAFVVRNVANLVPPYDQAKYAGTGAAIEYAVLHLKVSNIVVIGHSACGGIKGLLSFPFDGTYSTDFIEEWVKIGLPAKAKVKAQHGDAPFAE 267          
BLAST of FC920928 vs. ExPASy Swiss-Prot
Match: CAH2_ARATH (Carbonic anhydrase 2 OS=Arabidopsis thaliana GN=CA2 PE=1 SV=2)

HSP 1 Score: 253.447 bits (646), Expect = 7.341e-67
Identity = 130/198 (65.66%), Postives = 144/198 (72.73%), Query Frame = 3
Query:   63 MANYSYXXXXXXXXXXXXXXXXXXPVAAAKVEQITAQLQ--TPSDTKAFDSVERIKEGFIHFKREKYEKNPALYSELAKGQSPKYMVFACSDSRVCPSHVLDFQPGEAFVVRNVANIVPPYDQTKXXXXXXXXXXXXLHLKVSNIVVIGHSACGGIKGLMSFTFDGNNSTDFIEDWVKIGIPAKSKVFTEHGDKPFGD 650
            M N SY                   VAAAKV++ITA+LQ  + SD+K+FD VERIKEGF+ FK+EKYE NPALY ELAKGQSPKYMVFACSDSRVCPSHVLDF PG+AFVVRN+AN+VPP+D+ K            LHLKV NIVVIGHSACGGIKGLMSF  DGNNSTDFIEDWVKI +PAKSKV  E     F D
Sbjct:    1 MGNESYEDAIEALKKLLIEKDDLKDVAAAKVKKITAELQAASSSDSKSFDPVERIKEGFVTFKKEKYETNPALYGELAKGQSPKYMVFACSDSRVCPSHVLDFHPGDAFVVRNIANMVPPFDKVKYAGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPLDGNNSTDFIEDWVKICLPAKSKVLAESESSAFED 198          
BLAST of FC920928 vs. ExPASy Swiss-Prot
Match: CAHX_FLABR (Carbonic anhydrase OS=Flaveria brownii PE=2 SV=1)

HSP 1 Score: 234.958 bits (598), Expect = 2.702e-61
Identity = 115/172 (66.86%), Postives = 129/172 (75.00%), Query Frame = 3
Query:  135 PVAAAKVEQITAQLQTPSDTKAFDSVERIKEGFIHFKREKYEKNPALYSELAKGQSPKYMVFACSDSRVCPSHVLDFQPGEAFVVRNVANIVPPYDQTKXXXXXXXXXXXXLHLKVSNIVVIGHSACGGIKGLMSFTFDGNNSTDFIEDWVKIGIPAKSKVFTEHGDKPFGD 650
            PVAAA+++QITAQ   P     FD VERIK GF+ FK EK+  NPALY ELAKGQSPK+MVFACSDSRVCPSHVLDFQPGEAFVVRNVAN+VPP+D+TK            LHLKV  I VIGHS CGGIKGLM+F  +G +STDFIEDWVK+ +PAKSKV  EH      D
Sbjct:   98 PVAAARIDQITAQAAAPDTKAPFDPVERIKSGFVKFKTEKFVTNPALYDELAKGQSPKFMVFACSDSRVCPSHVLDFQPGEAFVVRNVANMVPPFDKTKYSGVGAAVEYAVLHLKVQEIFVIGHSRCGGIKGLMTFPDEGPHSTDFIEDWVKVCLPAKSKVVAEHNGTHLDD 269          
BLAST of FC920928 vs. ExPASy Swiss-Prot
Match: CAH1_FLALI (Carbonic anhydrase 1 OS=Flaveria linearis PE=2 SV=1)

HSP 1 Score: 234.958 bits (598), Expect = 2.702e-61
Identity = 115/172 (66.86%), Postives = 129/172 (75.00%), Query Frame = 3
Query:  135 PVAAAKVEQITAQLQTPSDTKAFDSVERIKEGFIHFKREKYEKNPALYSELAKGQSPKYMVFACSDSRVCPSHVLDFQPGEAFVVRNVANIVPPYDQTKXXXXXXXXXXXXLHLKVSNIVVIGHSACGGIKGLMSFTFDGNNSTDFIEDWVKIGIPAKSKVFTEHGDKPFGD 650
            PVAAA+++QITAQ   P     FD VERIK GF+ FK EK+  NPALY ELAKGQSPK+MVFACSDSRVCPSHVLDFQPGEAFVVRNVAN+VPP+D+TK            LHLKV  I VIGHS CGGIKGLM+F  +G +STDFIEDWVK+ +PAKSKV  EH      D
Sbjct:   98 PVAAARIDQITAQAAAPDTKAPFDPVERIKSGFVKFKTEKFVTNPALYDELAKGQSPKFMVFACSDSRVCPSHVLDFQPGEAFVVRNVANMVPPFDKTKYSGVGAAVEYAVLHLKVQEIFVIGHSRCGGIKGLMTFPDEGPHSTDFIEDWVKVCLPAKSKVVAEHNGTHLDD 269          
BLAST of FC920928 vs. ExPASy Swiss-Prot
Match: CAHX_FLAPR (Carbonic anhydrase OS=Flaveria pringlei PE=2 SV=1)

HSP 1 Score: 233.417 bits (594), Expect = 7.861e-61
Identity = 114/172 (66.28%), Postives = 128/172 (74.42%), Query Frame = 3
Query:  135 PVAAAKVEQITAQLQTPSDTKAFDSVERIKEGFIHFKREKYEKNPALYSELAKGQSPKYMVFACSDSRVCPSHVLDFQPGEAFVVRNVANIVPPYDQTKXXXXXXXXXXXXLHLKVSNIVVIGHSACGGIKGLMSFTFDGNNSTDFIEDWVKIGIPAKSKVFTEHGDKPFGD 650
            PVAAA+++QITAQ   P     FD VERIK GF+ FK EK+  NP LY ELAKGQSPK+MVFACSDSRVCPSHVLDFQPGEAFVVRNVAN+VPP+D+TK            LHLKV  I VIGHS CGGIKGLM+F  +G +STDFIEDWVK+ +PAKSKV  EH      D
Sbjct:   97 PVAAARIDQITAQAAAPDTKAPFDPVERIKSGFVKFKTEKFVTNPVLYDELAKGQSPKFMVFACSDSRVCPSHVLDFQPGEAFVVRNVANMVPPFDKTKYSGVGAAVEYAVLHLKVQEIFVIGHSRCGGIKGLMTFPDEGPHSTDFIEDWVKVCLPAKSKVVAEHNGTHLDD 268          
BLAST of FC920928 vs. ExPASy Swiss-Prot
Match: CAHX_FLABI (Carbonic anhydrase OS=Flaveria bidentis PE=2 SV=2)

HSP 1 Score: 233.417 bits (594), Expect = 7.861e-61
Identity = 114/172 (66.28%), Postives = 128/172 (74.42%), Query Frame = 3
Query:  135 PVAAAKVEQITAQLQTPSDTKAFDSVERIKEGFIHFKREKYEKNPALYSELAKGQSPKYMVFACSDSRVCPSHVLDFQPGEAFVVRNVANIVPPYDQTKXXXXXXXXXXXXLHLKVSNIVVIGHSACGGIKGLMSFTFDGNNSTDFIEDWVKIGIPAKSKVFTEHGDKPFGD 650
            PVAA +++QITAQ   P     FD VERIK GF+ FK EK+  NPALY ELAKGQSPK+MVFACSDSRVCPSHVLDFQPGEAFVVRNVAN+VPP+D+TK            LHLKV  I VIGHS CGGIKGLM+F  +G +STDFIEDWVK+ +PAKSKV  EH      D
Sbjct:   98 PVAATRIDQITAQAAAPDTKAPFDPVERIKSGFVKFKTEKFVTNPALYDELAKGQSPKFMVFACSDSRVCPSHVLDFQPGEAFVVRNVANMVPPFDKTKYSGVGAAVEYAVLHLKVQEIFVIGHSRCGGIKGLMTFPDEGPHSTDFIEDWVKVCLPAKSKVVAEHNGTHLDD 269          
BLAST of FC920928 vs. ExPASy Swiss-Prot
Match: CAHC_SPIOL (Carbonic anhydrase, chloroplastic OS=Spinacia oleracea PE=1 SV=2)

HSP 1 Score: 228.409 bits (581), Expect = 2.529e-59
Identity = 113/170 (66.47%), Postives = 130/170 (76.47%), Query Frame = 3
Query:  141 AAAKVEQITAQLQTPSDTKAFDSVERIKEGFIHFKREKYEKNPALYSELAKGQSPKYMVFACSDSRVCPSHVLDFQPGEAFVVRNVANIVPPYDQTKXXXXXXXXXXXXLHLKVSNIVVIGHSACGGIKGLMSFTFDGNNSTDFIEDWVKIGIPAKSKVFTEHGDKPFGD 650
            AA+KV QIT++L       A   V+RIKEGFI FK+EKYEKNPALY EL+KGQ+PK+MVFACSDSRVCPSHVLDFQPGEAF+VRN+AN+VP +D+ K            LHLKV NIVVIGHSACGGIKGLMSF   G  +TDFIEDWVKI +PAK KV  EHG+  F +
Sbjct:   89 AASKVAQITSELADGGTPSASYPVQRIKEGFIKFKKEKYEKNPALYGELSKGQAPKFMVFACSDSRVCPSHVLDFQPGEAFMVRNIANMVPVFDKDKYAGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPDAGPTTTDFIEDWVKICLPAKHKVLAEHGNATFAE 258          
BLAST of FC920928 vs. ExPASy Swiss-Prot
Match: CAH2_FLALI (Carbonic anhydrase 2 (Fragment) OS=Flaveria linearis PE=2 SV=1)

HSP 1 Score: 182.185 bits (461), Expect = 2.078e-45
Identity = 87/129 (67.44%), Postives = 97/129 (75.19%), Query Frame = 3
Query:  264 NPALYSELAKGQSPKYMVFACSDSRVCPSHVLDFQPGEAFVVRNVANIVPPYDQTKXXXXXXXXXXXXLHLKVSNIVVIGHSACGGIKGLMSFTFDGNNSTDFIEDWVKIGIPAKSKVFTEHGDKPFGD 650
            NP LY ELAKGQSPK++VFACSDSRVCPSH+LDFQPGEAFVVRN+AN+VPPYD  K            LHLKV NIVVIGHS CGGIKGLMS   DG  ++DFIE WVK+G+PAKSKV     +  F D
Sbjct:    1 NPTLYGELAKGQSPKFLVFACSDSRVCPSHILDFQPGEAFVVRNIANMVPPYDTIKHSGAGAAIEYAVLHLKVENIVVIGHSCCGGIKGLMSIPDDGTPASDFIEQWVKLGLPAKSKVKANCNNLEFAD 129          
The following BLAST results are available for this feature:
BLAST of FC920928 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 19
Match NameE-valueIdentityDescription
CAHC_ARATH3.521e-6976.30Carbonic anhydrase, chloroplastic OS=Arabidopsis t... [more]
CAHC_TOBAC1.133e-6764.18Carbonic anhydrase, chloroplastic OS=Nicotiana tab... [more]
CAHC_PEA5.621e-6772.25Carbonic anhydrase, chloroplastic OS=Pisum sativum... [more]
CAH2_ARATH7.341e-6765.66Carbonic anhydrase 2 OS=Arabidopsis thaliana GN=CA... [more]
CAHX_FLABR2.702e-6166.86Carbonic anhydrase OS=Flaveria brownii PE=2 SV=1[more]
CAH1_FLALI2.702e-6166.86Carbonic anhydrase 1 OS=Flaveria linearis PE=2 SV=... [more]
CAHX_FLAPR7.861e-6166.28Carbonic anhydrase OS=Flaveria pringlei PE=2 SV=1[more]
CAHX_FLABI7.861e-6166.28Carbonic anhydrase OS=Flaveria bidentis PE=2 SV=2[more]
CAHC_SPIOL2.529e-5966.47Carbonic anhydrase, chloroplastic OS=Spinacia oler... [more]
CAH2_FLALI2.078e-4567.44Carbonic anhydrase 2 (Fragment) OS=Flaveria linear... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32014H09EF RVDevelop1 Citrus clementina cDNA clone C32014H09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920928 ID=FC920928|Name=FC920928|organism=Citrus clementina|type=EST|length=661bp
AGCTAAAGATCGTCAAANAAAAAGAAGAAGAAAAAAAAATTATTCTAATT
AATAGGGAAGACATGGCAAATTACTCGTACGAGGAAGCCATTGAAGCTCT
CAAGAAACTTCTCAAGGAGAAGGAAGACTTGAAACCTGTTGCTGCTGCAA
AAGTAGAGCAGATTACTGCGCAGCTACAGACTCCATCTGACACCAAAGCA
TTTGATTCCGTGGAGAGGATCAAAGAGGGCTTCATTCACTTCAAGAGAGA
AAAATACGAGAAAAATCCAGCTCTGTACTCTGAGCTAGCCAAAGGCCAAA
GCCCGAAGTATATGGTATTTGCCTGCTCAGACTCCAGGGTTTGCCCGTCC
CATGTGTTGGATTTTCAACCTGGGGAAGCTTTCGTGGTTCGCAATGTTGC
TAACATTGTTCCACCCTATGATCAGACTAAATATGCTGGAGTTGGAGCTG
CTGTCGAGTATGCAGTTTTGCATCTCAAGGTTTCAAACATTGTGGTCATT
GGGCACAGCGCCTGTGGTGGCATCAAAGGACTCATGTCTTTCACATTTGA
TGGAAACAACTCCACCGATTTCATTGAAGACTGGGTGAAAATTGGCATCC
CTGCCAAGTCTAAGGTGTTTACAGAGCATGGTGACAAGCCTTTTGGAGAC
AATGCACATAC
back to top