FC920929

Overview
NameFC920929
Unique NameFC920929
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length592
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10983 contig Ccv1_Contig10983:2..593. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920929 vs. ExPASy Swiss-Prot
Match: T5AT_TAXCH (Taxadien-5-alpha-ol O-acetyltransferase OS=Taxus chinensis PE=2 SV=1)

HSP 1 Score: 139.428 bits (350), Expect = 1.264e-32
Identity = 78/172 (45.35%), Postives = 102/172 (59.30%), Query Frame = 2
Query:   80 LIGPALAPKSHEVKQLSDIDDQQGLWFQV-PLIFFYKNNPSPSMKGKDPVKVIKEALSRALVYYYPFAGRLREGSNGKLMVDCNGEGVLFTEADADFSLDQLGDDEIKPPCPYLDELLYDVPGSEGTLGCPLLLFQVTRLICGGFVLAFRVNHTMCDAFGFVQFLKAMEEMA 592
            ++GP+L P      QLS ID+  G+   +   +  Y  +PSP+M   DP K+I+EAL++ LVYY PFAGRLRE  NG L V+C GEG +F EA AD  L  LGD +   P     +LL+ +P        PLL+ QVTR  CGGFV+    +H +CD  G  QFLK + EMA
Sbjct:   15 MVGPSL-PLPKTTLQLSSIDNLPGVRGSIFNALLIYNASPSPTMVSADPAKLIREALAKILVYYPPFAGRLRETENGDLEVECTGEGAMFLEAMADNELSVLGDFDDSNPS--FQQLLFSLPLDTNFKDLPLLVVQVTRFTCGGFVVGVSFHHGVCDGRGAAQFLKGLAEMA 183          
BLAST of FC920929 vs. ExPASy Swiss-Prot
Match: T5AT_TAXCU (Taxadien-5-alpha-ol O-acetyltransferase OS=Taxus cuspidata GN=TAT PE=1 SV=1)

HSP 1 Score: 132.88 bits (333), Expect = 1.183e-30
Identity = 76/172 (44.19%), Postives = 99/172 (57.56%), Query Frame = 2
Query:   80 LIGPALAPKSHEVKQLSDIDDQQGLWFQV-PLIFFYKNNPSPSMKGKDPVKVIKEALSRALVYYYPFAGRLREGSNGKLMVDCNGEGVLFTEADADFSLDQLGDDEIKPPCPYLDELLYDVPGSEGTLGCPLLLFQVTRLICGGFVLAFRVNHTMCDAFGFVQFLKAMEEMA 592
            ++GP+  P      QLS ID+  G+   +   +  Y  +PSP+M   DP K I+EAL++ LVYY PFAGRLRE  NG L V+C GEG +F EA AD  L  LGD +   P     +LL+ +P         LL+ QVTR  CGGFV+    +H +CD  G  QFLK + EMA
Sbjct:   15 MVGPS-PPLPKTTLQLSSIDNLPGVRGSIFNALLIYNASPSPTMISADPAKPIREALAKILVYYPPFAGRLRETENGDLEVECTGEGAMFLEAMADNELSVLGDFDDSNPS--FQQLLFSLPLDTNFKDLSLLVVQVTRFTCGGFVVGVSFHHGVCDGRGAAQFLKGLAEMA 183          
BLAST of FC920929 vs. ExPASy Swiss-Prot
Match: DBAT_TAXCU (10-deacetylbaccatin III 10-O-acetyltransferase OS=Taxus cuspidata PE=1 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 1.768e-26
Identity = 76/182 (41.76%), Postives = 100/182 (54.95%), Query Frame = 2
Query:   50 EFSVKRRAPELIGPALAPKSHEVKQLSDIDDQQGLWFQV-PLIFFYKNNPSPSMKGKDPVKVIKEALSRALVYYYPFAGRLREGSNGKLMVDCNGEGVLFTEADADFSLDQLGDDEIKPPCPYLDELLYDVPGSEGTLGCPLLLFQVTRLICGGFVLAFRVNHTMCDAFGFVQFLKAMEEMA 592
            EF V+     ++ P+  P      QLS +D+  G+   +   +  Y  +   S+   DP KVI++ALS+ LVYY PFAGRLR+  NG L V+C GEG LF EA AD  L  LGD  +    P L++LL+ +P          L+ QVTR  CGGFV+     H +CD  G  QFL AM EMA
Sbjct:    6 EFVVRSLERVMVAPS-QPSPKAFLQLSTLDNLPGVRENIFNTLLVYNASDRVSV---DPAKVIRQALSKVLVYYSPFAGRLRKKENGDLEVECTGEGALFVEAMADTDLSVLGD--LDDYSPSLEQLLFCLPPDTDIEDIHPLVVQVTRFTCGGFVVGVSFCHGICDGLGAGQFLIAMGEMA 181          
BLAST of FC920929 vs. ExPASy Swiss-Prot
Match: DBNBT_TAXCA (3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransferase OS=Taxus canadensis GN=TAX10 PE=1 SV=1)

HSP 1 Score: 110.538 bits (275), Expect = 6.287e-24
Identity = 70/185 (37.84%), Postives = 103/185 (55.68%), Query Frame = 2
Query:   50 EFSVKRRAPELIGPALAPKSHEVKQLSDIDDQ---QGLWFQVPLIFFYKNNPSPSMKGKDPVKVIKEALSRALVYYYPFAGRLREGSNGKLMVDCNGEGVLFTEADADFSLDQLGD-DEIKPPCPYLDELLYDVPGSEGTLGCPLLLFQVTRLICGGFVLAFRVNHTMCDAFGFVQFLKAMEEMA 592
            +F VK+  P ++ P+L P      QLS +D     +G+ F   L+F   +N S      DPVK+I+EALS+ LVYY+P AGRLR    G+L V+C G+G LF EA  + ++  L D D++ P      +L++  P         L++ QVTR  CGG  +   + H++CD  G  QF+ A+ EMA
Sbjct:    8 DFHVKKFDPVMVAPSL-PSPKATVQLSVVDSLTICRGI-FNTLLVFNAPDNISA-----DPVKIIREALSKVLVYYFPLAGRLRSKEIGELEVECTGDGALFVEAMVEDTISVLRDLDDLNPS---FQQLVFWHPLDTAIEDLHLVIVQVTRFTCGGIAVGVTLPHSVCDGRGAAQFVTALAEMA 182          
BLAST of FC920929 vs. ExPASy Swiss-Prot
Match: DBBT_TAXCU (2-alpha-hydroxytaxane 2-O-benzoyltransferase OS=Taxus cuspidata PE=1 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 9.079e-23
Identity = 73/182 (40.11%), Postives = 99/182 (54.40%), Query Frame = 2
Query:   53 FSVKRRAPELIGPAL-APKSHEVKQLSDIDDQ-QGLWFQVPLIFFYKNNPSPSMKGKDPVKVIKEALSRALVYYYPFAGRLREGSNGKLMVDCNGEGVLFTEADADFSLDQLGDDEIKPPCPYLDELLYDVPGSEGTLGCPLLLFQVTRLICGGFVLAFRVNHTMCDAFGFVQFLKAMEEMA 592
            F+V      ++ P L +PK+  +  LS ID++ +GL     ++  Y  +   S+   DP K I+EALS+ LVYY PFAGRLR   NG L V+C GEG +F EA AD  L  L D       P   +L++++          LL  QVTR  CGGFV+  R +H++ D  G  Q LK M EMA
Sbjct:    4 FNVDMIERVIVAPCLQSPKN--ILHLSPIDNKTRGL---TNILSVYNASQRVSVSA-DPAKTIREALSKVLVYYPPFAGRLRNTENGDLEVECTGEGAVFVEAMADNDLSVLQD--FNEYDPSFQQLVFNLREDVNIEDLHLLTVQVTRFTCGGFVVGTRFHHSVSDGKGIGQLLKGMGEMA 177          
BLAST of FC920929 vs. ExPASy Swiss-Prot
Match: HCBT3_DIACA (Anthranilate N-benzoyltransferase protein 3 OS=Dianthus caryophyllus GN=HCBT3 PE=1 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 2.166e-16
Identity = 52/144 (36.11%), Postives = 74/144 (51.39%), Query Frame = 2
Query:  185 KNNPSPSMKGKDPVKVIKEALSRALVYYYPFAGRLREGSNGKLMVDCNGEGVLFTEADADFSLDQLGD----DEIK----PPCPYLDELLYDVPGSEGTLGCPLLLFQVTRLICGGFVLAFRVNHTMCDAFGFVQFLKAMEEMA 592
            ++N  PS        ++ EALS+ALV YYP AGRL+   + +  +DCNGEG LF EA++   L+  GD    DE+     P C Y          S+G    PLL+ Q+TR  CGG  + F  +H +CD     +F  +   +A
Sbjct:   51 EDNIQPSSSMYFDANILIEALSKALVPYYPMAGRLKINGD-RYEIDCNGEGALFVEAESSHVLEDFGDFRPNDELHRVMVPTCDY----------SKGISSFPLLMVQLTRFRCGGVSIGFAQHHHVCDRMSHFEFNNSWARIA 183          
BLAST of FC920929 vs. ExPASy Swiss-Prot
Match: HCBT2_DIACA (Anthranilate N-benzoyltransferase protein 2 OS=Dianthus caryophyllus GN=HCBT2 PE=1 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 1.834e-15
Identity = 51/144 (35.42%), Postives = 72/144 (50.00%), Query Frame = 2
Query:  185 KNNPSPSMKGKDPVKVIKEALSRALVYYYPFAGRLREGSNGKLMVDCNGEGVLFTEADADFSLDQLGD----DEIK----PPCPYLDELLYDVPGSEGTLGCPLLLFQVTRLICGGFVLAFRVNHTMCDAFGFVQFLKAMEEMA 592
            ++N  PS        ++ EALS+ALV YYP AGRL+   + +  +DCN EG LF EA++   L+  GD    DE+     P C Y          S+G    PLL+ Q+TR  CGG  + F  +H  CD     +F  +   +A
Sbjct:   51 EDNIHPSSSMYFDANILIEALSKALVPYYPMAGRLKINGD-RYEIDCNAEGALFVEAESSHVLEDFGDFRPNDELHRVMVPTCDY----------SKGISSFPLLMVQLTRFRCGGVSIGFAQHHHACDGMSHFEFNNSWARIA 183          
BLAST of FC920929 vs. ExPASy Swiss-Prot
Match: HCBT1_DIACA (Anthranilate N-benzoyltransferase protein 1 OS=Dianthus caryophyllus GN=HCBT1 PE=1 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 3.128e-15
Identity = 50/144 (34.72%), Postives = 73/144 (50.69%), Query Frame = 2
Query:  185 KNNPSPSMKGKDPVKVIKEALSRALVYYYPFAGRLREGSNGKLMVDCNGEGVLFTEADADFSLDQLGD----DEIK----PPCPYLDELLYDVPGSEGTLGCPLLLFQVTRLICGGFVLAFRVNHTMCDAFGFVQFLKAMEEMA 592
            ++N  PS        ++ EALS+ALV +YP AGRL+   + +  +DCN EG LF EA++   L+  GD    DE+     P C Y          S+G    PLL+ Q+TR  CGG  + F  +H +CD     +F  +   +A
Sbjct:   51 EDNIHPSSSMYFDANILIEALSKALVPFYPMAGRLKINGD-RYEIDCNAEGALFVEAESSHVLEDFGDFRPNDELHRVMVPTCDY----------SKGISSFPLLMVQLTRFRCGGVSIGFAQHHHVCDGMAHFEFNNSWARIA 183          
BLAST of FC920929 vs. ExPASy Swiss-Prot
Match: VINSY_RAUSE (Vinorine synthase OS=Rauvolfia serpentina GN=ACT PE=1 SV=2)

HSP 1 Score: 67.781 bits (164), Expect = 4.674e-11
Identity = 54/179 (30.17%), Postives = 86/179 (48.04%), Query Frame = 2
Query:   59 VKRRAPELIGPAL-APKSHEVKQLSDIDDQQGLWFQVPLIFFYKNNPSPSMKGKDPVKV---IKEALSRALVYYYPFAGRLREGSNGKLMVDCNGEGVLFTEADADFSLDQLGDD--EIKPPCPYLDELLYDVPGSEGTLGCPLLLFQVTRLICGGFVLAFRVNHTMCDAFGFVQFLKA 577
            +++ + ELI P+   P+S +  ++S +D Q  L   +P I FY   P+P     DP +    +K++LS+ L ++YP AGR+   S+    VDCN  GV F EA     L Q   +  E++    YL    Y     E     PL + +++   CGG  +   ++H + D      FL A
Sbjct:    5 MEKVSEELILPSSPTPQSLKCYKISHLD-QLLLTCHIPFILFY---PNPLDSNLDPAQTSQHLKQSLSKVLTHFYPLAGRINVNSS----VDCNDSGVPFVEARVQAQLSQAIQNVVELEKLDQYLPSAAYPGGKIEVNEDVPLAV-KISFFECGGTAIGVNLSHKIADVLSLATFLNA 174          
The following BLAST results are available for this feature:
BLAST of FC920929 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 9
Match NameE-valueIdentityDescription
T5AT_TAXCH1.264e-3245.35Taxadien-5-alpha-ol O-acetyltransferase OS=Taxus c... [more]
T5AT_TAXCU1.183e-3044.19Taxadien-5-alpha-ol O-acetyltransferase OS=Taxus c... [more]
DBAT_TAXCU1.768e-2641.7610-deacetylbaccatin III 10-O-acetyltransferase OS=... [more]
DBNBT_TAXCA6.287e-2437.843'-N-debenzoyl-2'-deoxytaxol N-benzoyltransferase ... [more]
DBBT_TAXCU9.079e-2340.112-alpha-hydroxytaxane 2-O-benzoyltransferase OS=Ta... [more]
HCBT3_DIACA2.166e-1636.11Anthranilate N-benzoyltransferase protein 3 OS=Dia... [more]
HCBT2_DIACA1.834e-1535.42Anthranilate N-benzoyltransferase protein 2 OS=Dia... [more]
HCBT1_DIACA3.128e-1534.72Anthranilate N-benzoyltransferase protein 1 OS=Dia... [more]
VINSY_RAUSE4.674e-1130.17Vinorine synthase OS=Rauvolfia serpentina GN=ACT P... [more]
back to top
Properties
Property NameValue
Genbank descriptionC32014H10EF RVDevelop1 Citrus clementina cDNA clone C32014H10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920929 ID=FC920929|Name=FC920929|organism=Citrus clementina|type=EST|length=592bp
AAGCCAATAAGCCAATAACTTTTTGACGATGACCTTGACATTGCTTCAAG
AATTCTCAGTTAAACGGCGGGCGCCGGAACTTATTGGCCCGGCGTTGGCG
CCGAAAAGTCATGAAGTGAAGCAACTTTCCGATATCGATGACCAACAAGG
TCTATGGTTTCAAGTTCCATTAATATTTTTCTACAAGAATAATCCTTCAC
CTTCGATGAAAGGGAAAGATCCGGTTAAGGTCATCAAGGAAGCCCTGAGT
AGGGCACTTGTGTATTATTATCCTTTTGCTGGTAGGCTTAGAGAAGGGTC
CAATGGTAAGCTCATGGTGGACTGCAATGGTGAAGGAGTATTGTTTACTG
AGGCTGATGCTGACTTCTCACTTGATCAGCTTGGTGATGATGAAATTAAG
CCACCATGTCCATATTTGGATGAGCTACTTTATGATGTTCCAGGCTCCGA
AGGCACTCTTGGCTGCCCATTGTTGTTATTTCAGGTGACACGATTGATAT
GTGGAGGATTCGTACTTGCATTTCGGGTGAACCACACAATGTGCGATGCA
TTTGGTTTCGTGCAATTCTTGAAAGCCATGGAGGAAATGGCT
back to top