GH733233

Overview
NameGH733233
Unique NameGH733233
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length220
Libraries
Library NameType
Citrus clementina pistils cDNA-AFLP librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of GH733233 vs. ExPASy Swiss-Prot
Match: SRF3_ARATH (Protein STRUBBELIG-RECEPTOR FAMILY 3 OS=Arabidopsis thaliana GN=SRF3 PE=1 SV=1)

HSP 1 Score: 119.783 bits (299), Expect = 4.299e-27
Identity = 57/65 (87.69%), Postives = 61/65 (93.85%), Query Frame = -1
Query:   14 VTGRKSYDRTRNRGEQFLVRWAIPQLHDIDALSRMVDPSLSGQYPAKSLSHFADIISRXVQSEPE 208
            +TGR SYDR R+RGEQFLVRWAIPQLHDIDAL +MVDPSL+GQYPAKSLSHFADIISR VQSEPE
Sbjct:  683 LTGRMSYDRDRSRGEQFLVRWAIPQLHDIDALGKMVDPSLNGQYPAKSLSHFADIISRCVQSEPE 747          
BLAST of GH733233 vs. ExPASy Swiss-Prot
Match: SRF1_ARATH (Protein STRUBBELIG-RECEPTOR FAMILY 1 OS=Arabidopsis thaliana GN=SRF1 PE=2 SV=2)

HSP 1 Score: 118.627 bits (296), Expect = 9.576e-27
Identity = 55/65 (84.62%), Postives = 61/65 (93.85%), Query Frame = -1
Query:   14 VTGRKSYDRTRNRGEQFLVRWAIPQLHDIDALSRMVDPSLSGQYPAKSLSHFADIISRXVQSEPE 208
            +TGRKSYD+ R+RGEQFLVRWAIPQLHDIDAL++MVDPSL G YPAKSLSHFAD+ISR VQSEPE
Sbjct:  676 LTGRKSYDKKRDRGEQFLVRWAIPQLHDIDALAKMVDPSLKGDYPAKSLSHFADVISRCVQSEPE 740          
BLAST of GH733233 vs. ExPASy Swiss-Prot
Match: SRF8_ARATH (Protein STRUBBELIG-RECEPTOR FAMILY 8 OS=Arabidopsis thaliana GN=SRF8 PE=2 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 1.339e-20
Identity = 47/65 (72.31%), Postives = 53/65 (81.54%), Query Frame = -1
Query:   14 VTGRKSYDRTRNRGEQFLVRWAIPQLHDIDALSRMVDPSLSGQYPAKSLSHFADIISRXVQSEPE 208
            +TGRK  D +R R EQ LVRWA PQLHDIDALS+MVDPSL+G YPAKSLS FADII+  +Q EPE
Sbjct:  593 LTGRKPLDSSRTRAEQSLVRWATPQLHDIDALSKMVDPSLNGMYPAKSLSRFADIIALCIQPEPE 657          
BLAST of GH733233 vs. ExPASy Swiss-Prot
Match: SUB_ARATH (Protein STRUBBELIG OS=Arabidopsis thaliana GN=SUB PE=1 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 2.285e-20
Identity = 46/64 (71.88%), Postives = 53/64 (82.81%), Query Frame = -1
Query:   17 VTGRKSYDRTRNRGEQFLVRWAIPQLHDIDALSRMVDPSLSGQYPAKSLSHFADIISRXVQSEP 208
            +TGR+ +DRTR RG Q L +WAIP+LHDIDAL+RMVDPSL G YP KSLS FADIISR +Q EP
Sbjct:  688 LTGRRPFDRTRPRGHQTLAQWAIPRLHDIDALTRMVDPSLHGAYPMKSLSRFADIISRSLQMEP 751          
BLAST of GH733233 vs. ExPASy Swiss-Prot
Match: SRF6_ARATH (Protein STRUBBELIG-RECEPTOR FAMILY 6 OS=Arabidopsis thaliana GN=SRF6 PE=1 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 3.897e-20
Identity = 45/65 (69.23%), Postives = 53/65 (81.54%), Query Frame = -1
Query:   14 VTGRKSYDRTRNRGEQFLVRWAIPQLHDIDALSRMVDPSLSGQYPAKSLSHFADIISRXVQSEPE 208
            +TGRK +D TR+R EQ LVRWA PQLHDIDAL++MVDP+L G YP KSLS FAD+I+  VQ EPE
Sbjct:  611 LTGRKPFDSTRSRSEQSLVRWATPQLHDIDALAKMVDPALKGLYPVKSLSRFADVIALCVQPEPE 675          
BLAST of GH733233 vs. ExPASy Swiss-Prot
Match: SRF7_ARATH (Protein STRUBBELIG-RECEPTOR FAMILY 7 OS=Arabidopsis thaliana GN=SRF7 PE=1 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 5.089e-20
Identity = 45/65 (69.23%), Postives = 52/65 (80.00%), Query Frame = -1
Query:   14 VTGRKSYDRTRNRGEQFLVRWAIPQLHDIDALSRMVDPSLSGQYPAKSLSHFADIISRXVQSEPE 208
            +TGRK +D TR+R EQ LVRWA PQLHDIDAL +MVDP+L G YP KSLS FAD+I+  VQ EPE
Sbjct:  614 LTGRKPFDSTRSRSEQSLVRWATPQLHDIDALGKMVDPALKGLYPVKSLSRFADVIALCVQPEPE 678          
BLAST of GH733233 vs. ExPASy Swiss-Prot
Match: SRF5_ARATH (Protein STRUBBELIG-RECEPTOR FAMILY 5 OS=Arabidopsis thaliana GN=SRF5 PE=2 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 4.459e-16
Identity = 41/65 (63.08%), Postives = 48/65 (73.85%), Query Frame = -1
Query:   14 VTGRKSYDRTRNRGEQFLVRWAIPQLHDIDALSRMVDPSLSGQYPAKSLSHFADIISRXVQSEPE 208
            +TGR  +D  + R E+ LVRWA PQLHDIDALS + DP+L G YP KSLS FADII+  VQ EPE
Sbjct:  596 LTGRVPFDGEKPRPERSLVRWATPQLHDIDALSNIADPALHGLYPPKSLSRFADIIALCVQVEPE 660          
BLAST of GH733233 vs. ExPASy Swiss-Prot
Match: SRF4_ARATH (Protein STRUBBELIG-RECEPTOR FAMILY 4 OS=Arabidopsis thaliana GN=SRF4 PE=2 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 4.173e-14
Identity = 38/66 (57.58%), Postives = 46/66 (69.70%), Query Frame = -1
Query:   11 VTGRKSYDRTRNRGEQFLVRWAIPQLHDIDALSRMVDPSLSGQYPAKSLSHFADIISRXVQSEPEL 208
            +TGRK YD  R + EQ LVRWA PQL D+D L  MVDP+L G Y  +S+S FADI+S  V +EP L
Sbjct:  607 LTGRKPYDSGRPKAEQSLVRWAKPQLKDMDTLDEMVDPALCGLYAPESVSSFADIVSICVMTEPGL 672          
BLAST of GH733233 vs. ExPASy Swiss-Prot
Match: SRF2_ARATH (Protein STRUBBELIG-RECEPTOR FAMILY 2 OS=Arabidopsis thaliana GN=SRF2 PE=2 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 4.319e-11
Identity = 30/65 (46.15%), Postives = 46/65 (70.77%), Query Frame = -1
Query:   14 VTGRKSYDRTRNRGEQFLVRWAIPQLHDIDALSRMVDPSLSGQYPAKSLSHFADIISRXVQSEPE 208
            +TGRK++D +R RGEQ LV+WA  +LHD  +L +M+D  ++G + ++  S +ADIIS   Q+E E
Sbjct:  615 LTGRKAFDSSRPRGEQLLVKWASTRLHDRRSLEQMIDGGIAGTFSSRVASQYADIISLCTQAEKE 679          
The following BLAST results are available for this feature:
BLAST of GH733233 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 9
Match NameE-valueIdentityDescription
SRF3_ARATH4.299e-2787.69Protein STRUBBELIG-RECEPTOR FAMILY 3 OS=Arabidopsi... [more]
SRF1_ARATH9.576e-2784.62Protein STRUBBELIG-RECEPTOR FAMILY 1 OS=Arabidopsi... [more]
SRF8_ARATH1.339e-2072.31Protein STRUBBELIG-RECEPTOR FAMILY 8 OS=Arabidopsi... [more]
SUB_ARATH2.285e-2071.88Protein STRUBBELIG OS=Arabidopsis thaliana GN=SUB ... [more]
SRF6_ARATH3.897e-2069.23Protein STRUBBELIG-RECEPTOR FAMILY 6 OS=Arabidopsi... [more]
SRF7_ARATH5.089e-2069.23Protein STRUBBELIG-RECEPTOR FAMILY 7 OS=Arabidopsi... [more]
SRF5_ARATH4.459e-1663.08Protein STRUBBELIG-RECEPTOR FAMILY 5 OS=Arabidopsi... [more]
SRF4_ARATH4.173e-1457.58Protein STRUBBELIG-RECEPTOR FAMILY 4 OS=Arabidopsi... [more]
SRF2_ARATH4.319e-1146.15Protein STRUBBELIG-RECEPTOR FAMILY 2 OS=Arabidopsi... [more]
back to top
Properties
Property NameValue
Genbank descriptionU_8 Citrus clementina pistils cDNA-AFLP library Citrus clementina cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>GH733233 ID=GH733233|Name=GH733233|organism=Citrus clementina|type=EST|length=220bp
GACTGCGTACCAATTCAGGCTCAGACTGAACACRACGAGAAATAATGTCA
GCAAAATGGGATAACGATTTAGCAGGATATTGTCCACTAAGGGAAGGATC
AACCATCCTGGACAATGCATCAATGTCATGAAGCTGGGGAATCGCCCATC
TTACAAGGAATTGCTCACCGCGATTTCTTGTTCTGTCATAGGACTTACGG
CCTGTTACTCAGGACTCAKC
back to top