GH733239

Overview
NameGH733239
Unique NameGH733239
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length202
Libraries
Library NameType
Citrus clementina pistils cDNA-AFLP librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of GH733239 vs. ExPASy Swiss-Prot
Match: CIA30_ARATH (Probable complex I intermediate-associated protein 30 OS=Arabidopsis thaliana GN=At1g17350 PE=1 SV=2)

HSP 1 Score: 115.161 bits (287), Expect = 1.083e-25
Identity = 51/62 (82.26%), Postives = 55/62 (88.71%), Query Frame = 3
Query:   12 NSPGQQEDNSWQSFVFVPKDNWYIAKIPLARYLPTWRGNVIDAEMEMNPSRVVGMSLSVTQD 197
            NSPGQ EDNSWQ+FVF PKD+WY AKIPLARYLPTWRGNVID EMEMNP RV+GMSLSV  +
Sbjct:  140 NSPGQSEDNSWQAFVFAPKDSWYTAKIPLARYLPTWRGNVIDVEMEMNPGRVLGMSLSVNAE 201          
The following BLAST results are available for this feature:
BLAST of GH733239 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
CIA30_ARATH1.083e-2582.26Probable complex I intermediate-associated protein... [more]
back to top
Properties
Property NameValue
Genbank descriptionU_18 Citrus clementina pistils cDNA-AFLP library Citrus clementina cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>GH733239 ID=GH733239|Name=GH733239|organism=Citrus clementina|type=EST|length=202bp
GACTGCGTACCAATTCACCTGGGCAACAAGAAGATAATTCATGGCAATCT
TTCGTTTTTGTACCCAAAGATAACTGGTATATTGCAAAGATTCCTCTTGC
GCGATATTTACCAACATGGAGAGGAAATGTTATAGATGCAGAGATGGAGA
TGAACCCTTCTCGTGTTGTCGGCATGTCTCTATCGGTTACTCAGGACTCA
TC
back to top