GH733255

Overview
NameGH733255
Unique NameGH733255
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length330
Libraries
Library NameType
Citrus clementina pistils cDNA-AFLP librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15266 contig Ccv1_Contig15266:697..1026. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of GH733255 vs. ExPASy Swiss-Prot
Match: TCMO_POPTM (Trans-cinnamate 4-monooxygenase OS=Populus tremuloides GN=CYP73A13 PE=2 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 1.971e-35
Identity = 73/91 (80.22%), Postives = 76/91 (83.52%), Query Frame = -2
Query:   48 QFRPERFLEEESKVEANGNDFRYLPVGVGRRSCPXXXXXXXXXXXXXGRLVQNFELLPPPGQSKIDTAEKGGQFXLHILKHSTIVAKPRSF 320
            +FRPERFLEEE+KVEANGNDFRYLP GVGRRSCP             GRLVQNFELLPPPGQSKIDT+EKGGQF LHILKHSTIVAKPRSF
Sbjct:  415 EFRPERFLEEEAKVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKIDTSEKGGQFSLHILKHSTIVAKPRSF 505          
BLAST of GH733255 vs. ExPASy Swiss-Prot
Match: TCMO_GLYEC (Trans-cinnamate 4-monooxygenase OS=Glycyrrhiza echinata GN=CYP73A14 PE=2 SV=1)

HSP 1 Score: 146.747 bits (369), Expect = 3.361e-35
Identity = 73/91 (80.22%), Postives = 75/91 (82.42%), Query Frame = -2
Query:   48 QFRPERFLEEESKVEANGNDFRYLPVGVGRRSCPXXXXXXXXXXXXXGRLVQNFELLPPPGQSKIDTAEKGGQFXLHILKHSTIVAKPRSF 320
            +FRPERFLEEES VEANGNDFRYLP GVGRRSCP             GRLVQNFELLPPPGQSK+DTAEKGGQF LHILKHSTIVAKPRSF
Sbjct:  415 EFRPERFLEEESHVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKLDTAEKGGQFSLHILKHSTIVAKPRSF 505          
BLAST of GH733255 vs. ExPASy Swiss-Prot
Match: TCMO_HELTU (Trans-cinnamate 4-monooxygenase OS=Helianthus tuberosus GN=CYP73A1 PE=1 SV=1)

HSP 1 Score: 146.362 bits (368), Expect = 4.390e-35
Identity = 73/91 (80.22%), Postives = 75/91 (82.42%), Query Frame = -2
Query:   48 QFRPERFLEEESKVEANGNDFRYLPVGVGRRSCPXXXXXXXXXXXXXGRLVQNFELLPPPGQSKIDTAEKGGQFXLHILKHSTIVAKPRSF 320
            +FRPERFLEEE+KVEANGNDFRYLP GVGRRSCP             GRLVQNFELLPPPGQSKIDT EKGGQF LHILKHSTIVAKPRSF
Sbjct:  415 EFRPERFLEEEAKVEANGNDFRYLPFGVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKIDTDEKGGQFSLHILKHSTIVAKPRSF 505          
BLAST of GH733255 vs. ExPASy Swiss-Prot
Match: TCMO_CICAR (Trans-cinnamate 4-monooxygenase OS=Cicer arietinum GN=CYP73A19 PE=2 SV=2)

HSP 1 Score: 145.976 bits (367), Expect = 5.734e-35
Identity = 73/91 (80.22%), Postives = 74/91 (81.32%), Query Frame = -2
Query:   48 QFRPERFLEEESKVEANGNDFRYLPVGVGRRSCPXXXXXXXXXXXXXGRLVQNFELLPPPGQSKIDTAEKGGQFXLHILKHSTIVAKPRSF 320
            +FRPERFLEEES VEANGNDFRYLP GVGRRSCP             GRLVQNFELLPPPGQSKIDTAEKGGQF LHILKHSTIV KPRSF
Sbjct:  414 EFRPERFLEEESHVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKIDTAEKGGQFSLHILKHSTIVCKPRSF 504          
BLAST of GH733255 vs. ExPASy Swiss-Prot
Match: TCMO_POPKI (Trans-cinnamate 4-monooxygenase OS=Populus kitakamiensis GN=CYP73A16 PE=2 SV=1)

HSP 1 Score: 144.821 bits (364), Expect = 1.277e-34
Identity = 72/91 (79.12%), Postives = 75/91 (82.42%), Query Frame = -2
Query:   48 QFRPERFLEEESKVEANGNDFRYLPVGVGRRSCPXXXXXXXXXXXXXGRLVQNFELLPPPGQSKIDTAEKGGQFXLHILKHSTIVAKPRSF 320
            +FRPERFLEE +KVEANGNDFRYLP GVGRRSCP             GRLVQNFELLPPPGQSKIDT+EKGGQF LHILKHSTIVAKPRSF
Sbjct:  415 EFRPERFLEEGAKVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKIDTSEKGGQFSLHILKHSTIVAKPRSF 505          
BLAST of GH733255 vs. ExPASy Swiss-Prot
Match: TCMO_PEA (Trans-cinnamate 4-monooxygenase OS=Pisum sativum GN=CYP73A9 PE=2 SV=2)

HSP 1 Score: 144.05 bits (362), Expect = 2.179e-34
Identity = 71/91 (78.02%), Postives = 75/91 (82.42%), Query Frame = -2
Query:   48 QFRPERFLEEESKVEANGNDFRYLPVGVGRRSCPXXXXXXXXXXXXXGRLVQNFELLPPPGQSKIDTAEKGGQFXLHILKHSTIVAKPRSF 320
            +FRPERFLEEE+ VEANGNDFRYLP GVGRRSCP             GRLVQNFELLPPPGQSKIDT+EKGGQF LHILKHSTIVAKPR+F
Sbjct:  415 EFRPERFLEEEAHVEANGNDFRYLPFGVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKIDTSEKGGQFSLHILKHSTIVAKPRAF 505          
BLAST of GH733255 vs. ExPASy Swiss-Prot
Match: TCMO_CATRO (Trans-cinnamate 4-monooxygenase OS=Catharanthus roseus GN=CYP73A4 PE=2 SV=1)

HSP 1 Score: 144.05 bits (362), Expect = 2.179e-34
Identity = 71/91 (78.02%), Postives = 75/91 (82.42%), Query Frame = -2
Query:   48 QFRPERFLEEESKVEANGNDFRYLPVGVGRRSCPXXXXXXXXXXXXXGRLVQNFELLPPPGQSKIDTAEKGGQFXLHILKHSTIVAKPRSF 320
            +FRPERFLEEESKVEANGNDFRYLP GVGRRSCP             GRLVQNFELLPPPG+SKIDT+EKGGQF LHILKHSTIV KPR+F
Sbjct:  415 EFRPERFLEEESKVEANGNDFRYLPFGVGRRSCPGIILALPILGITIGRLVQNFELLPPPGKSKIDTSEKGGQFSLHILKHSTIVLKPRTF 505          
BLAST of GH733255 vs. ExPASy Swiss-Prot
Match: TCMO_MEDSA (Trans-cinnamate 4-monooxygenase OS=Medicago sativa GN=CYP73A3 PE=2 SV=1)

HSP 1 Score: 143.665 bits (361), Expect = 2.846e-34
Identity = 72/91 (79.12%), Postives = 74/91 (81.32%), Query Frame = -2
Query:   48 QFRPERFLEEESKVEANGNDFRYLPVGVGRRSCPXXXXXXXXXXXXXGRLVQNFELLPPPGQSKIDTAEKGGQFXLHILKHSTIVAKPRSF 320
            +FRPERFLEEES VEANGNDFRYLP GVGRRSCP             GRLVQN ELLPPPGQSKIDT+EKGGQF LHILKHSTIVAKPRSF
Sbjct:  416 EFRPERFLEEESHVEANGNDFRYLPFGVGRRSCPGIILALPILGITIGRLVQNVELLPPPGQSKIDTSEKGGQFSLHILKHSTIVAKPRSF 506          
BLAST of GH733255 vs. ExPASy Swiss-Prot
Match: TCMO_SOYBN (Trans-cinnamate 4-monooxygenase OS=Glycine max GN=CYP73A11 PE=2 SV=1)

HSP 1 Score: 142.895 bits (359), Expect = 4.854e-34
Identity = 71/91 (78.02%), Postives = 74/91 (81.32%), Query Frame = -2
Query:   48 QFRPERFLEEESKVEANGNDFRYLPVGVGRRSCPXXXXXXXXXXXXXGRLVQNFELLPPPGQSKIDTAEKGGQFXLHILKHSTIVAKPRSF 320
            +FRPERF EEES VEANGNDFRYLP GVGRRSCP             GRLVQNFELLPPPGQS+IDT+EKGGQF LHILKHSTIVAKPRSF
Sbjct:  416 EFRPERFFEEESLVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSQIDTSEKGGQFSLHILKHSTIVAKPRSF 506          
BLAST of GH733255 vs. ExPASy Swiss-Prot
Match: TCMO_PHAAU (Trans-cinnamate 4-monooxygenase OS=Phaseolus aureus GN=CYP73A2 PE=1 SV=1)

HSP 1 Score: 142.895 bits (359), Expect = 4.854e-34
Identity = 70/91 (76.92%), Postives = 74/91 (81.32%), Query Frame = -2
Query:   48 QFRPERFLEEESKVEANGNDFRYLPVGVGRRSCPXXXXXXXXXXXXXGRLVQNFELLPPPGQSKIDTAEKGGQFXLHILKHSTIVAKPRSF 320
            +FRPERF EEES VEANGNDFRYLP GVGRRSCP             GRLVQNFELLPPPGQS+IDT+EKGGQF LHILKHST+VAKPRSF
Sbjct:  415 EFRPERFFEEESHVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSQIDTSEKGGQFSLHILKHSTVVAKPRSF 505          
The following BLAST results are available for this feature:
BLAST of GH733255 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 14
Match NameE-valueIdentityDescription
TCMO_POPTM1.971e-3580.22Trans-cinnamate 4-monooxygenase OS=Populus tremulo... [more]
TCMO_GLYEC3.361e-3580.22Trans-cinnamate 4-monooxygenase OS=Glycyrrhiza ech... [more]
TCMO_HELTU4.390e-3580.22Trans-cinnamate 4-monooxygenase OS=Helianthus tube... [more]
TCMO_CICAR5.734e-3580.22Trans-cinnamate 4-monooxygenase OS=Cicer arietinum... [more]
TCMO_POPKI1.277e-3479.12Trans-cinnamate 4-monooxygenase OS=Populus kitakam... [more]
TCMO_PEA2.179e-3478.02Trans-cinnamate 4-monooxygenase OS=Pisum sativum G... [more]
TCMO_CATRO2.179e-3478.02Trans-cinnamate 4-monooxygenase OS=Catharanthus ro... [more]
TCMO_MEDSA2.846e-3479.12Trans-cinnamate 4-monooxygenase OS=Medicago sativa... [more]
TCMO_SOYBN4.854e-3478.02Trans-cinnamate 4-monooxygenase OS=Glycine max GN=... [more]
TCMO_PHAAU4.854e-3476.92Trans-cinnamate 4-monooxygenase OS=Phaseolus aureu... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionU_40 Citrus clementina pistils cDNA-AFLP library Citrus clementina cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>GH733255 ID=GH733255|Name=GH733255|organism=Citrus clementina|type=EST|length=330bp
GTGATGAGTCCTGAGTAACGTTACAACCAAATGGAATTGTGAAACTAGAA
TGATCTAGGCTTGGCAACAATGGTCGAGTGCTTCAAAATRTGCAAACKGA
ACTGCCCACCTTTCTCTGCAGTGTCAATCTTAGATTGACCTGGAGGAGGC
AAGAGCTCAAAGTTCTGTACCAAACGCCCAATAGTGATACCAAGAATTGG
CAAAGCAAGGATAATTCCAGGGCAGCTTCTTCTCCCAACACCGACAGGAA
GGTAACGGAAGTCATTTCCATTAGCCTCAACCTTGGACTCCTCCTCCAAA
AACCTCTCAGGCCTGAATTGGTACGCAGTC
back to top