GH733301
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of GH733301 vs. ExPASy Swiss-Prot
Match: RS6_TOBAC (40S ribosomal protein S6 (Fragment) OS=Nicotiana tabacum GN=RPS6 PE=2 SV=2) HSP 1 Score: 59.6918 bits (143), Expect = 2.415e-18 Identity = 28/39 (71.79%), Postives = 36/39 (92.31%), Query Frame = 2 Query: 140 RSRELPRSKAEAAEYQKLLATRLKEQRERRSESLAKKRS 256 + + + ++K+EAAEYQKLLA+RLKEQRE+RSESLAKKRS Sbjct: 149 KKKRIAKAKSEAAEYQKLLASRLKEQREKRSESLAKKRS 187 HSP 2 Score: 51.6026 bits (122), Expect = 2.415e-18 Identity = 28/43 (65.12%), Postives = 35/43 (81.40%), Query Frame = 1 Query: 37 FTTKSR*ARLARHRKLQRLVTPLTLQRKRARIAEKKQRIAKVQ 165 FTTK + ++ K+QRLVTPLTLQRKRARIA+KK+RIAK + Sbjct: 118 FTTKWKGSKAP---KIQRLVTPLTLQRKRARIADKKKRIAKAK 157
BLAST of GH733301 vs. ExPASy Swiss-Prot
Match: RS62_ARATH (40S ribosomal protein S6-2 OS=Arabidopsis thaliana GN=RPS6B PE=1 SV=3) HSP 1 Score: 55.4546 bits (132), Expect = 1.510e-17 Identity = 25/39 (64.10%), Postives = 35/39 (89.74%), Query Frame = 2 Query: 140 RSRELPRSKAEAAEYQKLLATRLKEQRERRSESLAKKRS 256 + + + ++ ++AA+YQKLLA+RLKEQR+RRSESLAKKRS Sbjct: 199 KKKRIAKANSDAADYQKLLASRLKEQRDRRSESLAKKRS 237 HSP 2 Score: 53.1434 bits (126), Expect = 1.510e-17 Identity = 28/42 (66.67%), Postives = 35/42 (83.33%), Query Frame = 1 Query: 34 TFTTKSR*ARLARHRKLQRLVTPLTLQRKRARIAEKKQRIAK 159 TFT K ++++ K+QRLVTPLTLQRKRARIA+KK+RIAK Sbjct: 165 TFTNKKG-KKVSKAPKIQRLVTPLTLQRKRARIADKKKRIAK 205
BLAST of GH733301 vs. ExPASy Swiss-Prot
Match: RS61_ARATH (40S ribosomal protein S6-1 OS=Arabidopsis thaliana GN=RPS6A PE=1 SV=2) HSP 1 Score: 55.8398 bits (133), Expect = 1.232e-16 Identity = 25/39 (64.10%), Postives = 36/39 (92.31%), Query Frame = 2 Query: 140 RSRELPRSKAEAAEYQKLLATRLKEQRERRSESLAKKRS 256 + +++ ++ ++AA+YQKLLA+RLKEQR+RRSESLAKKRS Sbjct: 199 KKKKIAKANSDAADYQKLLASRLKEQRDRRSESLAKKRS 237 HSP 2 Score: 49.6766 bits (117), Expect = 1.232e-16 Identity = 24/39 (61.54%), Postives = 32/39 (82.05%), Query Frame = 1 Query: 43 TKSR*ARLARHRKLQRLVTPLTLQRKRARIAEKKQRIAK 159 T + +++ K+QRLVTPLTLQRKRARIA+KK++IAK Sbjct: 167 TNKKGKEVSKAPKIQRLVTPLTLQRKRARIADKKKKIAK 205 The following BLAST results are available for this feature:
BLAST of GH733301 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 3
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >GH733301 ID=GH733301; Name=GH733301; organism=Citrus clementina; type=EST; length=302bpback to top |