BQ623097

Overview
NameBQ623097
Unique NameBQ623097
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length719
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig8 contig Csv1_Contig8:1..719. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623097 vs. ExPASy Swiss-Prot
Match: EXL3_ARATH (GDSL esterase/lipase EXL3 OS=Arabidopsis thaliana GN=EXL3 PE=2 SV=1)

HSP 1 Score: 271.552 bits (693), Expect = 3.059e-72
Identity = 128/239 (53.56%), Postives = 174/239 (72.80%), Query Frame = 2
Query:    2 PNLKPQDLVTGVSFASGGAGYDPLTSKVASALSMSDQLDLFKKALETIKATAGEEATANILSKGLFMVVSGSDDIANTYLSTPFRRGQYDINSYTDLTASSALSFLQELYGVGARRIGVLSLPPIGCVPVQRTLNGGIARGCSDFANQAAQIYNSKLQSVVDSLSKEFPDSRFVYFDIYNPLNSLIQNPPQYGFEVADKGCCGTGNLEGSILCNRLEDAATCPDASKYIFWDSYHPTGK 718
            PNLK +DL+TGVSFASGG+GYDP+T K+ + +S+ DQL  F++ +E +K   GE     I++  LF++V+GSDDIANTY  T   R +YD++SYT L + SA  F+ +LYG G RR+ V   PPIGCVP QRTL GGI R C+D  N+AA+++NSKL   +DSL K  P  + +Y +IY+PL  +IQNP  YGFEV++KGCCGTG +E ++LCN++  ++ CPD S ++FWDSYHPT K
Sbjct:  110 PNLKSKDLLTGVSFASGGSGYDPITPKLVAVISLEDQLSYFEEYIEKVKNIVGEARKDFIVANSLFLLVAGSDDIANTYY-TLRARPEYDVDSYTTLMSDSASEFVTKLYGYGVRRVAVFGAPPIGCVPSQRTLGGGILRDCADNYNEAAKLFNSKLSPKLDSLRKTLPGIKPIYINIYDPLFDIIQNPANYGFEVSNKGCCGTGAIEVAVLCNKI-TSSVCPDVSTHVFWDSYHPTEK 346          
BLAST of BQ623097 vs. ExPASy Swiss-Prot
Match: GDL4_ARATH (GDSL esterase/lipase At1g20120 OS=Arabidopsis thaliana GN=At1g20120 PE=2 SV=2)

HSP 1 Score: 253.447 bits (646), Expect = 8.620e-67
Identity = 121/237 (51.05%), Postives = 164/237 (69.20%), Query Frame = 2
Query:    2 PNLKPQDLVTGVSFASGGAGYDPLTSKVASALSMSDQLDLFKKALETIKATAGEEATANILSKGLFMVVSGSDDIANTYLSTPFRRGQYDINSYTDLTASSALSFLQELYGVGARRIGVLSLPPIGCVPVQRTLNGGIARGCSDFANQAAQIYNSKLQSVVDSLSKEFPDSRFVYFDIYNPLNSLIQNPPQYGFEVADKGCCGTGNLEGSILCNRLEDAATCPDASKYIFWDSYHPT 712
            P L  +DL+TGVSFASGG+GYDPLT  V SA+ MS QL  F++ +E +K   G+E   +I+SKGL +VV+GSDD+ANTY         YDI++YT   ASSA SF  +LY  GA++IG + + PIGC+P+QRT  GG+ R C+D  N AAQ++NSKL + ++ L+K   ++  VY DIY+  N +IQNP +YGF+  D+GCCGTG LE   LCN+   +  C + S ++FWDSYHPT
Sbjct:  145 PGLTQEDLLTGVSFASGGSGYDPLTPIVVSAIPMSKQLTYFQEYIEKVKGFVGKEKAEHIISKGLAIVVAGSDDLANTYYGEHLEEFLYDIDTYTSFMASSAASFAMQLYESGAKKIGFIGVSPIGCIPIQRTTRGGLKRKCADELNFAAQLFNSKLSTSLNELAKTMKNTTLVYIDIYSSFNDMIQNPKKYGFDEIDRGCCGTGLLELGPLCNKY-TSLLCKNVSSFMFWDSYHPT 380          
BLAST of BQ623097 vs. ExPASy Swiss-Prot
Match: EXL1_ARATH (GDSL esterase/lipase EXL1 OS=Arabidopsis thaliana GN=EXL1 PE=2 SV=1)

HSP 1 Score: 246.128 bits (627), Expect = 1.376e-64
Identity = 124/240 (51.67%), Postives = 163/240 (67.92%), Query Frame = 2
Query:    2 PNLKPQDLVTGVSFASGGAGYDPLTSKVA-SALSMSDQLDLFKKALETIKATAGEEATANILSKGLFMVVSGSDDIANTYLSTPFRRGQYDINSYTDLTASSALSFLQELYGVGARRIGVLSLPPIGCVPVQRTLNGGIARGCSDFANQAAQIYNSKLQSVVDSLSKEFPDSRFVYFDIYNPLNSLIQNPPQYGFEVADKGCCGTGNLEGSILCNRLEDAATCPDASKYIFWDSYHPTGK 718
            PNLKP++L+TGV+FASGGAGY PLT+K+A   + +  QL  F++ +E +K   GE+ T  I+   LF+V+ GS+DIAN + + P  R  Y + S+T L A +A SF Q LYG GARRI V   PPIGCVP QRT+ GG  R C    N AA+++N+KL + +D LS+   D   +Y DIY+PL  LI NP QYGF+VA+KGCCGTG +E + LCN    A+ CP  S Y+FWDS+HPT K
Sbjct:  119 PNLKPEELLTGVTFASGGAGYVPLTTKIAVGGIPLPQQLIYFEEYIEKLKQMVGEKRTKFIIKNSLFVVICGSNDIANDFFTLPPVRLHYTVASFTALMADNARSFAQTLYGYGARRILVFGAPPIGCVPSQRTVAGGPTRDCVARFNDAAKLFNTKLSANIDVLSRTLQDPTIIYIDIYSPLLDLILNPHQYGFKVANKGCCGTGLIEVTALCNNY-TASVCPIRSDYVFWDSFHPTEK 357          
BLAST of BQ623097 vs. ExPASy Swiss-Prot
Match: EXL2_ARATH (GDSL esterase/lipase EXL2 OS=Arabidopsis thaliana GN=EXL2 PE=2 SV=1)

HSP 1 Score: 243.047 bits (619), Expect = 1.165e-63
Identity = 123/252 (48.81%), Postives = 164/252 (65.08%), Query Frame = 2
Query:    2 PNLKPQDLVTGVSFASGGAGYDPLTSKVASAL-------------SMSDQLDLFKKALETIKATAGEEATANILSKGLFMVVSGSDDIANTYLSTPFRRGQYDINSYTDLTASSALSFLQELYGVGARRIGVLSLPPIGCVPVQRTLNGGIARGCSDFANQAAQIYNSKLQSVVDSLSKEFPDSRFVYFDIYNPLNSLIQNPPQYGFEVADKGCCGTGNLEGSILCNRLEDAATCPDASKYIFWDSYHPTGK 718
            PNLKP+DL+TGV+FASGGAGY P T+++++ L             ++S QL LF++ +E +K   GEE T  I+   LFMV+ GS+DI NTY   P  + QYD+ S+T L A +A SF Q+L+  GARRI V   PP+GCVP QRTL GG  R C    N A ++YN KL + + SLS+   D   +Y DIY+ L  +I +P QYGF+V DKGCCGTG +E ++LCN    A  CP+  +Y+FWDS+HPT K
Sbjct:  115 PNLKPEDLLTGVTFASGGAGYVPFTTQLSTYLFIYKPLLFLKGGIALSQQLKLFEEYVEKMKKMVGEERTKLIIKNSLFMVICGSNDITNTYFGLPSVQQQYDVASFTTLMADNARSFAQKLHEYGARRIQVFGAPPVGCVPSQRTLAGGPTRNCVVRFNDATKLYNVKLAANLGSLSRTLGDKTIIYVDIYDSLLDIILDPRQYGFKVVDKGCCGTGLIEVALLCNNFA-ADVCPNRDEYVFWDSFHPTEK 365          
BLAST of BQ623097 vs. ExPASy Swiss-Prot
Match: GDL90_ARATH (GDSL esterase/lipase At5g42170 OS=Arabidopsis thaliana GN=At5g42160/At5g42170 PE=3 SV=2)

HSP 1 Score: 241.891 bits (616), Expect = 2.596e-63
Identity = 117/239 (48.95%), Postives = 164/239 (68.62%), Query Frame = 2
Query:    2 PNLKPQDLVTGVSFASGGAGYDPLTSKVASALSMSDQLDLFKKALETIKATAGEEATANILSKGLFMVVSGSDDIANTYLSTPFRRGQYDINSYTDLTASSALSFLQELYGVGARRIGVLSLPPIGCVPVQRTLNGGIARGCSDFANQAAQIYNSKLQSVVDSLSKEFPDSRFVYFDIYNPLNSLIQNPPQYGFEVADKGCCGTGNLEGSILCNRLEDAATCPDASKYIFWDSYHPTGK 718
            P LK +DL+ GV+FASGG+GYDPLT+K+   +S+SDQL  F++    +K   GEE    ++   L++VV+ S+DIA+TY +   R  +Y+  SY D  A SA  F+  LYG+GARRIGV S  P+GCVP  RTL G + R CS+  N+ A+ +N+K+   +++L KE PDSR V  D+ + LN +I+NP  YGFEV+++GCCGTG +E   LCN++ +  TC ++S YIFWDSYHPT K
Sbjct:  117 PKLKNEDLLKGVNFASGGSGYDPLTAKLVKVVSLSDQLKNFQEYKNKLKVIVGEEKANFLVKNSLYLVVASSNDIAHTYTA---RSIKYNKTSYADYLADSASKFVSALYGLGARRIGVFSAVPVGCVPAARTLRGKLKRRCSEKLNEVARNFNAKISPTLEALGKELPDSRVVLIDVCDTLNDMIENPKNYGFEVSNRGCCGTGLVEVLFLCNKI-NPFTCKNSSSYIFWDSYHPTEK 351          
BLAST of BQ623097 vs. ExPASy Swiss-Prot
Match: GDL26_ARATH (GDSL esterase/lipase At1g59030/At1g59406 OS=Arabidopsis thaliana GN=At1g59030 PE=2 SV=1)

HSP 1 Score: 234.572 bits (597), Expect = 4.144e-61
Identity = 121/238 (50.84%), Postives = 164/238 (68.91%), Query Frame = 2
Query:    2 PNLKPQDLVTGVSFASGGAGYDPLTSKVASALSMSDQLDLFKKALETIKATAGEEATANILSKGLFMVVSGSDDIANTYLSTPFRRGQYDINSYTDLTASSALSFLQELYGVGARRIGVLSLPPIGCVPVQRTLNGG-IARGCSDFANQAAQIYNSKLQSVVDSLSKEFPDSRFVYFDIYNPLNSLIQNPPQYGFEVADKGCCGTGNLEGSILCNRLEDAATCPDASKYIFWDSYHPT 712
            P LKP+DL+ GV+FASGG GYDPLT+K+ S +S+ DQL  FK+ +  IK   GEE   +IL    F+VVS S+D+A+TYL+   R   YD  SY +  A SA+ F++EL+ +GAR+IGV S  P+GCVP+QRT+ GG   RGC+   N  A+ +N++L   +DSL KE  D   +Y ++Y+ L  +IQ+P +YGFEVAD+GCCG G L  S LCN L +  TC ++S YIFWDSYHP+
Sbjct:   97 PYLKPEDLLKGVTFASGGTGYDPLTAKIMSVISVWDQLINFKEYISKIKRHFGEEKAKDILEHSFFLVVSSSNDLAHTYLAQTHR---YDRTSYANFLADSAVHFVRELHKLGARKIGVFSAVPVGCVPLQRTVFGGFFTRGCNQPLNNMAKQFNARLSPALDSLDKEL-DGVILYINVYDTLFDMIQHPKKYGFEVADRGCCGKGLLAISYLCNSL-NPFTCSNSSAYIFWDSYHPS 329          
BLAST of BQ623097 vs. ExPASy Swiss-Prot
Match: GDL25_ARATH (GDSL esterase/lipase At1g58725 OS=Arabidopsis thaliana GN=At1g58725 PE=2 SV=2)

HSP 1 Score: 234.572 bits (597), Expect = 4.144e-61
Identity = 121/238 (50.84%), Postives = 164/238 (68.91%), Query Frame = 2
Query:    2 PNLKPQDLVTGVSFASGGAGYDPLTSKVASALSMSDQLDLFKKALETIKATAGEEATANILSKGLFMVVSGSDDIANTYLSTPFRRGQYDINSYTDLTASSALSFLQELYGVGARRIGVLSLPPIGCVPVQRTLNGG-IARGCSDFANQAAQIYNSKLQSVVDSLSKEFPDSRFVYFDIYNPLNSLIQNPPQYGFEVADKGCCGTGNLEGSILCNRLEDAATCPDASKYIFWDSYHPT 712
            P LKP+DL+ GV+FASGG GYDPLT+K+ S +S+ DQL  FK+ +  IK   GEE   +IL    F+VVS S+D+A+TYL+   R   YD  SY +  A SA+ F++EL+ +GAR+IGV S  P+GCVP+QRT+ GG   RGC+   N  A+ +N++L   +DSL KE  D   +Y ++Y+ L  +IQ+P +YGFEVAD+GCCG G L  S LCN L +  TC ++S YIFWDSYHP+
Sbjct:   97 PYLKPEDLLKGVTFASGGTGYDPLTAKIMSVISVWDQLINFKEYISKIKRHFGEEKAKDILEHSFFLVVSSSNDLAHTYLAQTHR---YDRTSYANFLADSAVHFVRELHKLGARKIGVFSAVPVGCVPLQRTVFGGFFTRGCNQPLNNMAKQFNARLSPALDSLDKEL-DGVILYINVYDTLFDMIQHPKKYGFEVADRGCCGKGLLAISYLCNSL-NPFTCSNSSAYIFWDSYHPS 329          
BLAST of BQ623097 vs. ExPASy Swiss-Prot
Match: GDL52_ARATH (GDSL esterase/lipase At3g14820 OS=Arabidopsis thaliana GN=At3g14820 PE=3 SV=2)

HSP 1 Score: 233.032 bits (593), Expect = 1.206e-60
Identity = 122/238 (51.26%), Postives = 158/238 (66.39%), Query Frame = 2
Query:    5 NLKPQDLVTGVSFASGGAGYDPLTSKVASALSMSDQLDLFKKALETIKATAGEEATANILSKGLFMVVSGSDDIANTYLSTPFRRGQYDINSYTDLTASSALSFLQELYGVGARRIGVLSLPPIGCVPVQRTLNGGIARGCSDFANQAAQIYNSKLQSVVDSLSKEFPDSRFVYFDIYNPLNSLIQNPPQYGFEVADKGCCGTGNLEGSILCNRLEDAATCPDASKYIFWDSYHPTGK 718
            NLKP DL+ GV FASGG+GYDPLTS + S +SMSDQL  F++ L  IK   GEE    IL K +F+VVS S+D+A TY     R  +YD NSY +     A  F++EL  +GA+ IG+ S  P+GC+P QRTL GG  R C +  N  A  +NSKL S +D+L KE P SR ++ D+Y+ L  +I+NP  YGF+VADKGCCGTG +E   LCN+     TC DAS ++F+DSYHP+ K
Sbjct:  100 NLKPHDLLKGVIFASGGSGYDPLTSTLLSVVSMSDQLKYFQEYLAKIKQHFGEEKVKFILEKSVFLVVSSSNDLAETYW---VRSVEYDRNSYAEYLVELASEFIKELSELGAKNIGLFSGVPVGCLPAQRTLFGGFERKCYEKLNNMALHFNSKLSSSLDTLKKELP-SRLIFIDVYDTLLDIIKNPTNYGFKVADKGCCGTGKIELMELCNKF-TPFTCSDASTHVFFDSYHPSEK 332          
BLAST of BQ623097 vs. ExPASy Swiss-Prot
Match: APG_ARATH (Anter-specific proline-rich protein APG OS=Arabidopsis thaliana GN=APG PE=2 SV=2)

HSP 1 Score: 220.32 bits (560), Expect = 8.087e-57
Identity = 113/247 (45.75%), Postives = 155/247 (62.75%), Query Frame = 2
Query:    2 PNLKPQDLVTGVSFASGGAGYDPLTSKVASALSMSDQLDLFKKALETIKAT----------AGEEATANILSKGLFMVVSGSDDIANTYLSTPFRRGQYDINSYTDLTASSALSFLQELYGVGARRIGVLSLPPIGCVPVQRTLNGGIARGCSDFANQAAQIYNSKLQSVVDSLSKEFPDSRFVYFDIYNPLNSLIQNPPQYGFEVADKGCCGTGNLEGSILCNRLEDAATCPDASKYIFWDSYHPT 712
            P ++P DL+TGVSFASGGAGY+P TS+ A+A+ M DQL  F+  +E +             AG E T  ++SKG+ +VV GS+D+  TY  +  +R + DI+SYT + A SA SF+ +LYG GARRIGV+  PP+GCVP QR     I   C++  N A+Q++NSKL  ++  LSK  P+S FVY DIY  ++ +++ P  YGFE   K CC TG L    LC +   +  CP+ S Y+FWD  HPT
Sbjct:  271 PKIQPNDLLTGVSFASGGAGYNPTTSEAANAIPMLDQLTYFQDYIEKVNRLVRQEKSQYKLAGLEKTNQLISKGVAIVVGGSNDLIITYFGSGAQRLKNDIDSYTTIIADSAASFVLQLYGYGARRIGVIGTPPLGCVPSQRLKKKKI---CNEELNYASQLFNSKLLLILGQLSKTLPNSTFVYMDIYTIISQMLETPAAYGFEETKKPCCKTGLLSAGALCKK-STSKICPNTSSYLFWDGVHPT 513          
BLAST of BQ623097 vs. ExPASy Swiss-Prot
Match: GDL24_ARATH (GDSL esterase/lipase At1g58480 OS=Arabidopsis thaliana GN=At1g58480 PE=3 SV=1)

HSP 1 Score: 211.846 bits (538), Expect = 2.876e-54
Identity = 113/236 (47.88%), Postives = 156/236 (66.10%), Query Frame = 2
Query:    8 LKPQDLVTGVSFASGGAGYDPLTSKVASALSMSDQLDLFKKALETIKATAGEEATANILSKGLFMVVSGSDDIANTYLSTPFRRGQYDINSYTDLTASSALSFLQELYGVGARRIGVLSLPPIGCVPVQRTLNGG-IARGCSDFANQAAQIYNSKLQSVVDSLSKEFPDSRFVYFDIYNPLNSLIQNPPQYGFEVADKGCCGTGNLEGSILCNRLEDAATCPDASKYIFWDSYHPT 712
            LKP+DL+ GV+FAS G GYDPLT+K+ S +S+ DQL  FK+ +  IK   GEE   +IL    F+VVS S+D+A+TYL+   R   YD  SY +  A SA+ F++EL+ +GAR+IGV S  P+GCVP+QRT+ GG   RGC++  N  A+ +N++L   +DSL KE  D   +Y ++Y+ L  +IQ+P +Y       GCCG G L  S LCN L +  TC ++S YIFWDSYHP+
Sbjct:   99 LKPEDLLKGVTFASRGTGYDPLTAKIMSVISVWDQLIYFKEYISKIKRHFGEEKAKDILEHSFFLVVSSSNDLAHTYLAQAHR---YDRTSYANFLADSAVHFVRELHKLGARKIGVFSAVPVGCVPLQRTVFGGFFTRGCNEPLNNMAKQFNARLSPALDSLDKEL-DGVILYINVYDTLFDMIQHPKKY-------GCCGKGLLTISYLCNSL-NPFTCSNSSSYIFWDSYHPS 322          
The following BLAST results are available for this feature:
BLAST of BQ623097 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 92
Match NameE-valueIdentityDescription
EXL3_ARATH3.059e-7253.56GDSL esterase/lipase EXL3 OS=Arabidopsis thaliana ... [more]
GDL4_ARATH8.620e-6751.05GDSL esterase/lipase At1g20120 OS=Arabidopsis thal... [more]
EXL1_ARATH1.376e-6451.67GDSL esterase/lipase EXL1 OS=Arabidopsis thaliana ... [more]
EXL2_ARATH1.165e-6348.81GDSL esterase/lipase EXL2 OS=Arabidopsis thaliana ... [more]
GDL90_ARATH2.596e-6348.95GDSL esterase/lipase At5g42170 OS=Arabidopsis thal... [more]
GDL26_ARATH4.144e-6150.84GDSL esterase/lipase At1g59030/At1g59406 OS=Arabid... [more]
GDL25_ARATH4.144e-6150.84GDSL esterase/lipase At1g58725 OS=Arabidopsis thal... [more]
GDL52_ARATH1.206e-6051.26GDSL esterase/lipase At3g14820 OS=Arabidopsis thal... [more]
APG_ARATH8.087e-5745.75Anter-specific proline-rich protein APG OS=Arabido... [more]
GDL24_ARATH2.876e-5447.88GDSL esterase/lipase At1g58480 OS=Arabidopsis thal... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00188 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00188 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623097 ID=BQ623097|Name=BQ623097|organism=Citrus sinensis|type=EST|length=719bp
TCCAAATCTAAAGCCTCAAGACCTTGTTACTGGCGTAAGTTTTGCCTCAG
GTGGAGCTGGATATGATCCTCTTACATCAAAAGTAGCGTCTGCGTTATCA
ATGTCGGATCAATTGGACTTGTTCAAGAAAGCATTAGAGACAATAAAAGC
TACAGCGGGAGAAGAAGCAACTGCAAATATACTATCAAAAGGCTTATTCA
TGGTGGTCTCCGGAAGTGATGATATTGCAAATACTTATTTATCAACTCCA
TTCAGGAGAGGCCAATATGATATCAATTCCTATACTGATTTAACAGCTAG
TTCAGCTTTAAGTTTCTTACAGGAACTGTATGGAGTTGGAGCAAGGAGAA
TAGGAGTACTTAGTTTACCACCAATTGGGTGTGTGCCAGTACAGAGAACA
CTCAATGGGGGCATCGCTAGAGGCTGTTCAGATTTTGCCAATCAAGCTGC
TCAAATCTACAACTCGAAGCTCCAATCTGTAGTTGATTCTCTCAGTAAAG
AGTTTCCAGATTCAAGATTTGTCTACTTTGATATCTACAATCCACTGAAT
TCTCTTATCCAAAACCCTCCTCAATATGGGTTTGAAGTGGCAGATAAAGG
GTGCTGCGGCACTGGAAATTTAGAGGGTAGCATACTGTGCAATCGTTTGG
AGGATGCAGCGACATGCCCGGATGCATCCAAATACATATTCTGGGACAGT
TACCATCCCACGGGAAAGG
back to top