BQ623101

Overview
NameBQ623101
Unique NameBQ623101
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length646
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig12771 contig Csv1_Contig12771:132..777. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623101 vs. ExPASy Swiss-Prot
Match: ISPF_ARATH (2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase, chloroplastic OS=Arabidopsis thaliana GN=ISPF PE=1 SV=1)

HSP 1 Score: 259.996 bits (663), Expect = 7.579e-69
Identity = 124/136 (91.18%), Postives = 131/136 (96.32%), Query Frame = 3
Query:  237 LPFRVGHGFDLHRLEPGYPLIIGGINVPHERGCEAHSDGDVLLHCVVDAILGALGLPDIGQIFPDSDPKWKGAPSSVFIKEAVRLMDEAGYEIGNLDATLILQRPKLSPYKETIRTNLSELLGADPPGGNLKAKTH 644
            LPFR+GHGFDLHRLEPGYPLIIGGI +PH+RGCEAHSDGDVLLHCVVDAILGALGLPDIGQIFPDSDPKWKGA SSVFIKEAVRLMDEAGYEIGNLDATLILQRPK+SP+KETIR+NLS+LLGADP   NLKAKTH
Sbjct:   73 LPFRIGHGFDLHRLEPGYPLIIGGIVIPHDRGCEAHSDGDVLLHCVVDAILGALGLPDIGQIFPDSDPKWKGAASSVFIKEAVRLMDEAGYEIGNLDATLILQRPKISPHKETIRSNLSKLLGADPSVVNLKAKTH 208          
BLAST of BQ623101 vs. ExPASy Swiss-Prot
Match: ISPF_CATRO (2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase, chloroplastic OS=Catharanthus roseus GN=ISPF PE=2 SV=1)

HSP 1 Score: 256.529 bits (654), Expect = 8.379e-68
Identity = 122/136 (89.71%), Postives = 129/136 (94.85%), Query Frame = 3
Query:  237 LPFRVGHGFDLHRLEPGYPLIIGGINVPHERGCEAHSDGDVLLHCVVDAILGALGLPDIGQIFPDSDPKWKGAPSSVFIKEAVRLMDEAGYEIGNLDATLILQRPKLSPYKETIRTNLSELLGADPPGGNLKAKTH 644
            L FRVGHGFDLHRLEPGYPLIIGGIN+PH+RGCEAHSDGDVLLHCVVDAILGALGLPDIGQIFPD+DPKWKGAPSSVFIKEAVRLMDEAGYE+GNLDATLILQRPK+SP+KE IR NL +LLGADP   NLKAKTH
Sbjct:   78 LSFRVGHGFDLHRLEPGYPLIIGGINIPHDRGCEAHSDGDVLLHCVVDAILGALGLPDIGQIFPDTDPKWKGAPSSVFIKEAVRLMDEAGYELGNLDATLILQRPKVSPHKEAIRQNLCQLLGADPCVVNLKAKTH 213          
BLAST of BQ623101 vs. ExPASy Swiss-Prot
Match: ISPDF_ERYLH (Bifunctional enzyme ispD/ispF OS=Erythrobacter litoralis (strain HTCC2594) GN=ispDF PE=3 SV=1)

HSP 1 Score: 154.066 bits (388), Expect = 5.857e-37
Identity = 69/135 (51.11%), Postives = 96/135 (71.11%), Query Frame = 3
Query:  237 LPFRVGHGFDLHRLEPGYPLIIGGINVPHERGCEAHSDGDVLLHCVVDAILGALGLPDIGQIFPDSDPKWKGAPSSVFIKEAVRLMDEAGYEIGNLDATLILQRPKLSPYKETIRTNLSELLGADPPGGNLKAKT 641
            LP RVG GFD+H+LE G  L +GGI + H++G   HSD DV LH +VDA+LGA+G  DIG  FP SDP+WKGA SS FI+ A +L+DEAGY +GN+D T+I + P++ P+++ +   ++ELL   P   ++KA T
Sbjct:  224 LPVRVGTGFDVHKLEAGEELWLGGIRLEHDKGLAGHSDADVALHAIVDALLGAIGKGDIGDHFPPSDPQWKGAASSAFIEHAAKLVDEAGYRVGNIDLTIICEAPRIGPHRDAMGQRIAELLATSPDAISVKATT 358          
BLAST of BQ623101 vs. ExPASy Swiss-Prot
Match: ISPF_ACIBL (2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase OS=Acidobacteria bacterium (strain Ellin345) GN=ispF PE=3 SV=1)

HSP 1 Score: 151.369 bits (381), Expect = 3.796e-36
Identity = 69/132 (52.27%), Postives = 92/132 (69.70%), Query Frame = 3
Query:  246 RVGHGFDLHRLEPGYPLIIGGINVPHERGCEAHSDGDVLLHCVVDAILGALGLPDIGQIFPDSDPKWKGAPSSVFIKEAVRLMDEAGYEIGNLDATLILQRPKLSPYKETIRTNLSELLGADPPGGNLKAKT 641
            RVG GFD H    G PL IGG+ +PH  G   HSDGDVLLH + DA+LGA+   DIG  FP SDPKWKGA S VFI+EA+R ++ AGY +GN+D +L+L  PK+ P+ + I+ ++++LL  +P    +KAKT
Sbjct:    3 RVGLGFDSHEFREGIPLRIGGLTIPHTHGLSGHSDGDVLLHAITDALLGAVAAGDIGAFFPPSDPKWKGANSVVFIEEAMRHIETAGYRVGNVDCSLVLNAPKIGPHAKAIQESVAKLLKIEPTAVGIKAKT 134          
BLAST of BQ623101 vs. ExPASy Swiss-Prot
Match: ISPF_RALME (2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase OS=Ralstonia metallidurans (strain CH34 / ATCC 43123 / DSM 2839) GN=ispF PE=3 SV=1)

HSP 1 Score: 150.599 bits (379), Expect = 6.475e-36
Identity = 72/133 (54.14%), Postives = 96/133 (72.18%), Query Frame = 3
Query:  246 RVGHGFDLHRLEPGYPLIIGGINVPHERGCEAHSDGDVLLHCVVDAILGALGLPDIGQIFPDSDPKWKGAPSSVFIKEAVRLMDEAGYEIGNLDATLILQRPKLSPYKETIRTNLSELLGADPPGGNLKAKTH 644
            R+G G+D+H L PG  LI+GG+++PH+RG   HSD D LLH V DA+ GA  L DIG+ FPD+DP + GA S V ++EAVR + EAGYEIGN+DAT+I Q+PKL+P+   +  NL+E LG      N+KAKT+
Sbjct:    7 RIGQGYDVHALVPGRKLILGGVDIPHDRGLLGHSDADALLHAVTDALFGAAALGDIGRHFPDTDPNFAGADSRVLLREAVRRVREAGYEIGNVDATVIAQKPKLAPHISGMVANLAEDLGLPVTRCNVKAKTN 139          
BLAST of BQ623101 vs. ExPASy Swiss-Prot
Match: ISPF_LYSSC (2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase OS=Lysinibacillus sphaericus (strain C3-41) GN=ispF PE=3 SV=1)

HSP 1 Score: 148.288 bits (373), Expect = 3.214e-35
Identity = 68/133 (51.13%), Postives = 96/133 (72.18%), Query Frame = 3
Query:  243 FRVGHGFDLHRLEPGYPLIIGGINVPHERGCEAHSDGDVLLHCVVDAILGALGLPDIGQIFPDSDPKWKGAPSSVFIKEAVRLMDEAGYEIGNLDATLILQRPKLSPYKETIRTNLSELLGADPPGGNLKAKT 641
            FR+G GFD+H  E G PLIIGGI +PHE+G   HSD DVLLH V DA LGA+G  DIG+ FPD+DP +K A S+  ++   +++++ GY +GN+D T++ QRPK++PY E ++  ++ELL A+P   N+KA T
Sbjct:    2 FRIGQGFDVHAFEEGRPLIIGGITIPHEKGLVGHSDADVLLHTVTDAALGAIGEGDIGRHFPDTDPAFKDADSAKLLEYIWKIVEDKGYILGNVDCTIMAQRPKMAPYIEQMQNRIAELLHAEPSQVNVKATT 134          
BLAST of BQ623101 vs. ExPASy Swiss-Prot
Match: ISPF_RALPJ (2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase OS=Ralstonia pickettii (strain 12J) GN=ispF PE=3 SV=1)

HSP 1 Score: 147.132 bits (370), Expect = 7.160e-35
Identity = 69/136 (50.74%), Postives = 95/136 (69.85%), Query Frame = 3
Query:  237 LPFRVGHGFDLHRLEPGYPLIIGGINVPHERGCEAHSDGDVLLHCVVDAILGALGLPDIGQIFPDSDPKWKGAPSSVFIKEAVRLMDEAGYEIGNLDATLILQRPKLSPYKETIRTNLSELLGADPPGGNLKAKTH 644
            +  R+G G+D+H L  G  LI+GG+ +PH RG   HSD D LLH + DA+ GA GL DIG+ FPD+DP + GA S V ++EAVR + +AGY +GN+DAT+I Q+PKL+P+   +  NL+E LG  P   N+KAKT+
Sbjct:    4 MDIRIGQGYDVHALVEGRKLILGGVEIPHTRGLLGHSDADALLHAITDALFGAAGLGDIGRHFPDTDPAFAGADSRVLLREAVRRVHKAGYAVGNVDATVIAQKPKLAPHVPGMVANLAEDLGIAPERCNVKAKTN 139          
BLAST of BQ623101 vs. ExPASy Swiss-Prot
Match: ISPF_RALSO (2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase OS=Ralstonia solanacearum GN=ispF PE=3 SV=1)

HSP 1 Score: 146.747 bits (369), Expect = 9.351e-35
Identity = 69/136 (50.74%), Postives = 95/136 (69.85%), Query Frame = 3
Query:  237 LPFRVGHGFDLHRLEPGYPLIIGGINVPHERGCEAHSDGDVLLHCVVDAILGALGLPDIGQIFPDSDPKWKGAPSSVFIKEAVRLMDEAGYEIGNLDATLILQRPKLSPYKETIRTNLSELLGADPPGGNLKAKTH 644
            +  R+G G+D+H L  G  LI+GG+ +PH RG   HSD D LLH + DA+ GA GL DIG+ FPD+DP + GA S V ++EAVR + EAGY++GN+DAT+I Q+PKL+P+   +  NL+  LG  P   N+KAKT+
Sbjct:    4 MDIRIGQGYDVHALVEGRKLILGGVEIPHTRGLLGHSDADALLHAITDALFGAAGLGDIGRHFPDTDPAFAGADSRVLLREAVRRVREAGYDVGNVDATVIAQKPKLAPHVPGMVANLAADLGIAPGRCNVKAKTN 139          
BLAST of BQ623101 vs. ExPASy Swiss-Prot
Match: ISPF_GEOSL (2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase OS=Geobacter sulfurreducens GN=ispF PE=3 SV=1)

HSP 1 Score: 146.747 bits (369), Expect = 9.351e-35
Identity = 67/132 (50.76%), Postives = 94/132 (71.21%), Query Frame = 3
Query:  246 RVGHGFDLHRLEPGYPLIIGGINVPHERGCEAHSDGDVLLHCVVDAILGALGLPDIGQIFPDSDPKWKGAPSSVFIKEAVRLMDEAGYEIGNLDATLILQRPKLSPYKETIRTNLSELLGADPPGGNLKAKT 641
            R+GHG+D+HRL  G  LI+GG+++PHE G   HSD DVLLH + DAILGAL L DIG+ FPD+DP++KGA S   ++  + L    G+ +GNLDAT++ QRPK++P+   +R +++  L ADP   N+KA T
Sbjct:    2 RIGHGYDVHRLVAGRKLIVGGVDIPHELGLLGHSDADVLLHAISDAILGALALGDIGKHFPDTDPRYKGADSRALLRHVMELATRKGFHLGNLDATIVAQRPKMAPHIPLMREHIAADLMADPDRVNVKATT 133          
BLAST of BQ623101 vs. ExPASy Swiss-Prot
Match: ISPF_RALEJ (2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase OS=Ralstonia eutropha (strain JMP134) GN=ispF PE=3 SV=1)

HSP 1 Score: 145.591 bits (366), Expect = 2.083e-34
Identity = 70/138 (50.72%), Postives = 99/138 (71.74%), Query Frame = 3
Query:  237 LPF--RVGHGFDLHRLEPGYPLIIGGINVPHERGCEAHSDGDVLLHCVVDAILGALGLPDIGQIFPDSDPKWKGAPSSVFIKEAVRLMDEAGYEIGNLDATLILQRPKLSPYKETIRTNLSELLGADPPGGNLKAKTH 644
            +PF  RVG G+D+H L PG  LI+GG+++PH+RG   HSD D LLH + DA+ GA GL DIG+ FPD+D ++ GA S V ++EA R + EAGYEIGN+DA++I Q+PKL+P+   +  N+++ LG      N+KAKT+
Sbjct:    2 MPFDIRVGQGYDVHALVPGRKLILGGVHIPHDRGLLGHSDADALLHAITDALFGAAGLGDIGRHFPDTDAQFAGADSRVLLREAARRVREAGYEIGNVDASVIAQQPKLAPHIPGMVANIADDLGLPATRCNVKAKTN 139          
The following BLAST results are available for this feature:
BLAST of BQ623101 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
ISPF_ARATH7.579e-6991.182-C-methyl-D-erythritol 2,4-cyclodiphosphate synth... [more]
ISPF_CATRO8.379e-6889.712-C-methyl-D-erythritol 2,4-cyclodiphosphate synth... [more]
ISPDF_ERYLH5.857e-3751.11Bifunctional enzyme ispD/ispF OS=Erythrobacter lit... [more]
ISPF_ACIBL3.796e-3652.272-C-methyl-D-erythritol 2,4-cyclodiphosphate synth... [more]
ISPF_RALME6.475e-3654.142-C-methyl-D-erythritol 2,4-cyclodiphosphate synth... [more]
ISPF_LYSSC3.214e-3551.132-C-methyl-D-erythritol 2,4-cyclodiphosphate synth... [more]
ISPF_RALPJ7.160e-3550.742-C-methyl-D-erythritol 2,4-cyclodiphosphate synth... [more]
ISPF_RALSO9.351e-3550.742-C-methyl-D-erythritol 2,4-cyclodiphosphate synth... [more]
ISPF_GEOSL9.351e-3550.762-C-methyl-D-erythritol 2,4-cyclodiphosphate synth... [more]
ISPF_RALEJ2.083e-3450.722-C-methyl-D-erythritol 2,4-cyclodiphosphate synth... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00192 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00192 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623101 ID=BQ623101|Name=BQ623101|organism=Citrus sinensis|type=EST|length=646bp
AGATGGTGTTGACGATGGCCGCTCAATCATACACCACCACTCCTCTCCAC
AGCAAAATTACGAATAAGCCACTATGTCCTCCTCCGTTGAGTTTGAAGCC
TCGTAGCTTAACCGCCAAACATCTCCGCACAACACAGTCAACGTCGCTGC
CTCGTATTTCAGTTTCAGCTGCAGCCATTTCTTCCATCGAAGTTAAAGAG
TCATCGGCTTCGATCCAACCGTCCAAATCAAAATCACTGCCTTTTCGTGT
GGGCCACGGGTTTGATCTTCATAGATTGGAGCCTGGCTACCCTCTGATCA
TCGGTGGAATCAATGTTCCCCACGAGAGAGGCTGCGAGGCTCACTCTGAC
GGTGATGTTTTGCTTCACTGTGTTGTGGATGCAATTTTGGGAGCATTGGG
TCTTCCTGATATTGGTCAGATATTTCCTGATTCTGATCCTAAGTGGAAGG
GTGCACCATCCTCTGTTTTTATCAAAGAAGCTGTGAGACTCATGGATGAG
GCCGGCTATGAGATTGGCAACTTGGATGCCACGCTGATTCTTCAAAGACC
AAAATTGAGCCCATACAAGGAGACTATCCGAACCAACTTGTCTGAACTGC
TAGGAGCAGACCCCCCCGGTGGAAATCTGAAAGCGAAAACTCATGA
back to top