BQ623106

Overview
NameBQ623106
Unique NameBQ623106
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length690
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig11326 contig Csv1_Contig11326:581..1270. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623106 vs. ExPASy Swiss-Prot
Match: FAD1_SCHPO (Probable FAD synthetase OS=Schizosaccharomyces pombe GN=SPCC1235.04c PE=2 SV=1)

HSP 1 Score: 115.931 bits (289), Expect = 2.019e-25
Identity = 54/109 (49.54%), Postives = 70/109 (64.22%), Query Frame = 1
Query:   13 KPIRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPILDWSYRDVWAFILTCKVQYCSLYDQGYTSIGSIHDTVPNALLCVSDSSNNQEKFKPAYMLSDGRLERAGR 339
            K I+AI +G+R  DP  + +  F  +  GWP FMR+ PILDWSY ++W  +L    +YCSLYD+GYTS+G + DT PN  L      N    + PAY+LSDG LERAGR
Sbjct:  134 KHIQAILIGIRRLDPHGLHRIAFEVTDKGWPKFMRIQPILDWSYTEIWDLLLETNTKYCSLYDRGYTSLGGVSDTSPNPAL-----KNPDGTYSPAYLLSDGSLERAGR 237          
BLAST of BQ623106 vs. ExPASy Swiss-Prot
Match: FAD1_HUMAN (FAD synthetase OS=Homo sapiens GN=FLAD1 PE=1 SV=1)

HSP 1 Score: 107.457 bits (267), Expect = 7.181e-23
Identity = 51/108 (47.22%), Postives = 70/108 (64.81%), Query Frame = 1
Query:   19 IRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPILDWSYRDVWAFILTCKVQYCSLYDQGYTSIGSIHDTVPN-ALLCVSDSSNNQEKFKPAYMLSDGRLERAGR 339
            + A+ +G R  DP +     FSP+ PGWP FMR+NP+LDW+YRD+W F+    V YC LYD+GYTS+GS  +TV N AL C+S   +    ++PAY+L +   ER  R
Sbjct:  481 LEAVLMGTRRTDPYSCSLCPFSPTDPGWPAFMRINPLLDWTYRDIWDFLRQLFVPYCILYDRGYTSLGSRENTVRNPALKCLSPGGH--PTYRPAYLLENEEEERNSR 586          
BLAST of BQ623106 vs. ExPASy Swiss-Prot
Match: FAD1_MOUSE (FAD synthetase OS=Mus musculus GN=Flad1 PE=1 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 2.089e-22
Identity = 49/109 (44.95%), Postives = 70/109 (64.22%), Query Frame = 1
Query:   19 IRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPILDWSYRDVWAFILTCKVQYCSLYDQGYTSIGSIHDTVPN-ALLCVSDSSNNQEKFKPAYMLSDGRLERAGRV 342
            + A+ +G R  DP +     FSP+ PGWP FMR+NP+LDW+YR++W F+    V YC LYD+GYTS+GS  +T  N AL C+S   +    ++PAY+L +   ER  R+
Sbjct:  386 LEAVLMGTRRTDPYSCSLSHFSPTDPGWPSFMRINPLLDWTYRNIWEFLRQLFVPYCILYDRGYTSLGSRENTTQNPALKCLSPGGH--PVYRPAYLLENEDEERNSRM 492          
BLAST of BQ623106 vs. ExPASy Swiss-Prot
Match: FAD1_DANRE (FAD synthetase OS=Danio rerio GN=flad1 PE=2 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 2.089e-22
Identity = 48/107 (44.86%), Postives = 69/107 (64.49%), Query Frame = 1
Query:   19 IRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPILDWSYRDVWAFILTCKVQYCSLYDQGYTSIGSIHDTVPNALLCVSDSSNNQEKFKPAYMLSDGRLERAGR 339
            +RA+ +G R  DP +     F P+ PGWP +MRVNP+L+W+Y D+W+F+ T  V YC LYD+GYTS+GS+ ++  N  L + D      ++KPAYML +   ER  R
Sbjct:  391 LRAVLMGTRRTDPYSHTLTPFCPTDPGWPDYMRVNPLLEWTYHDIWSFLRTLYVPYCILYDKGYTSLGSMDNSYRNPSLKMVD-ERGATRYKPAYMLENEEEERNSR 496          
BLAST of BQ623106 vs. ExPASy Swiss-Prot
Match: FAD1_PONAB (FAD synthetase OS=Pongo abelii GN=FLAD1 PE=2 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 3.017e-21
Identity = 48/107 (44.86%), Postives = 66/107 (61.68%), Query Frame = 1
Query:   19 IRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPILDWSYRDVWAFILTCKVQYCSLYDQGYTSIGSIHDTVPNALLCVSDSSNNQEKFKPAYMLSDGRLERAGR 339
            + A+ +G R  DP +     FSP+ PGWP FMR+NP+LDW+YRD+W F+    V YC LYD+GYTS+GS  +TV +  L    S      ++PAY+L +   ER  R
Sbjct:  385 LEAVLMGTRRTDPYSCSLCPFSPTDPGWPAFMRINPLLDWTYRDIWDFLRQLFVPYCILYDRGYTSLGSRENTVRDPAL-KRLSPGGHPTYRPAYLLENEEEERNSR 490          
BLAST of BQ623106 vs. ExPASy Swiss-Prot
Match: FLAD1_XENLA (FAD synthetase OS=Xenopus laevis GN=flad1 PE=2 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 3.336e-20
Identity = 46/107 (42.99%), Postives = 64/107 (59.81%), Query Frame = 1
Query:   19 IRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPILDWSYRDVWAFILTCKVQYCSLYDQGYTSIGSIHDTVPNALLCVSDSSNNQEKFKPAYMLSDGRLERAGR 339
            + A+ +G R  DP +        + P WP +MRVNP+LDWSYRD+W F+ T  + YC LYD+GYTS+GS+ +TV N  L  +  +   E + PAY L +   ER  R
Sbjct:  390 LEAVLMGTRRSDPYSRTLTPMCLTDPDWPKYMRVNPLLDWSYRDIWDFLRTLFIPYCILYDKGYTSLGSMENTVKNPALRFTTPA-GAESYHPAYKLQNEEEERVSR 495          

HSP 2 Score: 68.5514 bits (166), Expect = 3.697e-11
Identity = 35/84 (41.67%), Postives = 50/84 (59.52%), Query Frame = 1
Query:  427 ASAIAVGDEILFGTIEDQLGPSLCKKLHSIGWSVSQIAGLQNDIDSVAEEVERQKASHDMVFVYGGVGPLHSNVTLTGVARLLG 678
            A  I +GDEIL G  +D     +CKKL SIG  V++I+ + +DID +A E+    + +  V   GG+GP H +VT  GVA+  G
Sbjct:   17 AGIIIIGDEILKGHTQDTNSFFMCKKLRSIGVQVNKISVIPDDIDIIAGEIAGFSSRYTYVLTSGGIGPTHDDVTFEGVAKAFG 100          
BLAST of BQ623106 vs. ExPASy Swiss-Prot
Match: FLAD1_CAEEL (Probable FAD synthetase OS=Caenorhabditis elegans GN=R53.1 PE=2 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 1.039e-13
Identity = 43/107 (40.19%), Postives = 60/107 (56.07%), Query Frame = 1
Query:   28 IFLGVRIGDPTAVGQEQFSP---SSPGWPPFMRVNPILDWSYRDVWAFILTCKVQYCSLYDQGYTSIGSIHDTVPNALLCVSDSSNNQEKFKPAYMLSDGRLERAGR 339
            + +G R  DP   G+   +P   +   WP  +RV PIL+W+Y DVW  +    V YC LYDQGYTS+G   +TV +  L +  SS+ +E + PAY L +   ER  R
Sbjct:  413 VLMGSRATDPN--GKYMKTPVEWTDSDWPQVLRVCPILNWTYTDVWHMLRGLCVPYCKLYDQGYTSLGGRDNTVKHPALRIV-SSDGREHYLPAYKLHNDAEERCNR 516          

HSP 2 Score: 68.1662 bits (165), Expect = 4.828e-11
Identity = 31/80 (38.75%), Postives = 49/80 (61.25%), Query Frame = 1
Query:  427 ASAIAVGDEILFGTIEDQLGPSLCKKLHSIGWSVSQIAGLQNDIDSVAEEVERQKASHDMVFVYGGVGPLHSNVTLTGVA 666
            A+ + +GDEIL GT  D     LCK+LH +G ++ +I+ + +DI  ++ EV+    ++D V   GGVGP H + T  G+A
Sbjct:   16 AAILVIGDEILKGTTRDTNSHFLCKRLHKLGVNIRKISVIGDDISEISREVQSASGAYDYVITSGGVGPTHDDKTYLGLA 95          
BLAST of BQ623106 vs. ExPASy Swiss-Prot
Match: FLAD1_CAEBR (Probable FAD synthetase OS=Caenorhabditis briggsae GN=CBG00973 PE=3 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 1.773e-13
Identity = 42/107 (39.25%), Postives = 61/107 (57.01%), Query Frame = 1
Query:   28 IFLGVRIGDPTAVGQEQFSP---SSPGWPPFMRVNPILDWSYRDVWAFILTCKVQYCSLYDQGYTSIGSIHDTVPNALLCVSDSSNNQEKFKPAYMLSDGRLERAGR 339
            + +G R  DP   G+   +P   +   WP  +RV PIL+W+Y DVW  +    V YC LYDQGYTS+G   +TV +  L +  +S+ +E + PAY L +   ER+ R
Sbjct:  417 VLMGSRATDPN--GKYMKTPVEWTDSDWPKVLRVCPILNWTYSDVWHMLRGLCVPYCKLYDQGYTSLGGRDNTVKHPALRIV-ASDGKEHYLPAYKLHNDAEERSNR 520          

HSP 2 Score: 68.5514 bits (166), Expect = 3.697e-11
Identity = 31/80 (38.75%), Postives = 50/80 (62.50%), Query Frame = 1
Query:  427 ASAIAVGDEILFGTIEDQLGPSLCKKLHSIGWSVSQIAGLQNDIDSVAEEVERQKASHDMVFVYGGVGPLHSNVTLTGVA 666
            A+ + +GDEIL GT  D     LCK+LH +G ++ +IA + ++I  ++ EV+   +++D V   GGVGP H + T  G+A
Sbjct:   19 AAIVVIGDEILKGTTRDTNSHFLCKRLHKLGVNIKKIAVVGDEISEISREVQSASSAYDYVITSGGVGPTHDDKTYLGLA 98          
BLAST of BQ623106 vs. ExPASy Swiss-Prot
Match: FAD1_YEAST (FAD synthetase OS=Saccharomyces cerevisiae GN=FAD1 PE=1 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 4.367e-12
Identity = 44/147 (29.93%), Postives = 66/147 (44.90%), Query Frame = 1
Query:   25 AIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPILDWSYRDVWAFILTCKVQYCSLYDQGYTSIGSIHDTVPNALLCVSDSSN---------------------------------NQEKFK-------PAYMLSDGRLERAGRVK 345
            AI +G+R  DP     +    +   WP FMR+ P+L W   ++W+F+L      C LY +G+TSIG I++++PN  L   DS+N                                 ++E+F        P + L D  LERAGR+K
Sbjct:  160 AIVIGIRHTDPFGEALKPIQRTDSNWPDFMRLQPLLHWDLTNIWSFLLYSNEPICGLYGKGFTSIGGINNSLPNPHL-RKDSNNPALHFEWEIIHAFGKDAEGERSSAINTSPISVVDKERFSKYHDNYYPGWYLVDDTLERAGRIK 305          
The following BLAST results are available for this feature:
BLAST of BQ623106 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 9
Match NameE-valueIdentityDescription
FAD1_SCHPO2.019e-2549.54Probable FAD synthetase OS=Schizosaccharomyces pom... [more]
FAD1_HUMAN7.181e-2347.22FAD synthetase OS=Homo sapiens GN=FLAD1 PE=1 SV=1[more]
FAD1_MOUSE2.089e-2244.95FAD synthetase OS=Mus musculus GN=Flad1 PE=1 SV=1[more]
FAD1_DANRE2.089e-2244.86FAD synthetase OS=Danio rerio GN=flad1 PE=2 SV=1[more]
FAD1_PONAB3.017e-2144.86FAD synthetase OS=Pongo abelii GN=FLAD1 PE=2 SV=1[more]
FLAD1_XENLA3.336e-2042.99FAD synthetase OS=Xenopus laevis GN=flad1 PE=2 SV=... [more]
FLAD1_CAEEL1.039e-1340.19Probable FAD synthetase OS=Caenorhabditis elegans ... [more]
FLAD1_CAEBR1.773e-1339.25Probable FAD synthetase OS=Caenorhabditis briggsae... [more]
FAD1_YEAST4.367e-1229.93FAD synthetase OS=Saccharomyces cerevisiae GN=FAD1... [more]
back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00197 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00197 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623106 ID=BQ623106|Name=BQ623106|organism=Citrus sinensis|type=EST|length=690bp
TTATTAAATGCTAAACCAATCAGAGCTATTTTCCTTGGTGTGCGAATTGG
TGATCCTACAGCGGTTGGTCAAGAACAGTTCTCCCCAAGTTCACCGGGAT
GGCCTCCTTTCATGAGAGTGAATCCCATATTGGATTGGTCGTACAGAGAT
GTGTGGGCCTTCATCTTAACTTGCAAGGTCCAGTACTGCAGTCTTTATGA
TCAGGGCTATACTTCAATTGGAAGCATACATGACACTGTTCCAAATGCAT
TATTGTGCGTCAGTGATTCCTCCAATAACCAAGAGAAATTTAAACCTGCA
TACATGCTTTCTGATGGAAGATTGGAGAGAGCAGGGAGAGTTAAAAAAGT
TTCTCCTTCAATTTGTGGGACAGCCGTTGCTAATGTCATGGACAATGTAG
ATTCACATAAAAGCAGCTTACTGAAAGCCTCAGCCATTGCTGTTGGCGAT
GAGATTCTGTTTGGCACCATTGAGGATCAACTGGGACCTTCATTGTGTAA
AAAGTTGCATTCTATCGGTTGGTCTGTATCACAAATTGCTGGTCTTCAGA
ATGATATAGATTCTGTGGCTGAAGAGGTTGAACGACAAAAAGCATCCCAT
GATATGGTATTTGTGTATGGAGGGGTAGGCCCCCTGCACTCAAATGTTAC
ATTAACTGGGGTTGCAAGGCTTTTGGGGGTCCCCTGGCTC
back to top