BQ623113

Overview
NameBQ623113
Unique NameBQ623113
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length630
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
BQ623113_ssr13 microsatellite BQ623113_ssr13:13..24. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig8493 contig Csv1_Contig8493:114..743. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623113 vs. ExPASy Swiss-Prot
Match: CB26_ARATH (Chlorophyll a-b binding protein CP26, chloroplastic OS=Arabidopsis thaliana GN=LHCB5 PE=2 SV=1)

HSP 1 Score: 278.485 bits (711), Expect = 1.978e-74
Identity = 136/185 (73.51%), Postives = 151/185 (81.62%), Query Frame = 1
Query:   76 IGAKEMLGNPLNVSSAVRTSAPGASNPSTFKPVALFXXXXXXXXXXXXXXXXXXXNEELAKWYGPDRRIFLPEGLLDRSEIPEYLTGEVPGDYGYDPFGLSKKPDDFSKYQAYELIHARWAMLGAAGFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFGKNIPINLGFAVIAEIVLVGGA 630
            +G  EMLG PLN  +  R+SAP AS+PSTFK VALF                   ++ELAKWYGPDRRIFLP+GLLDRSEIPEYL GEV GDYGYDPFGL KKP++F+KYQA+ELIHARWAMLGAAGFIIPEA NK+GANCGPEAVWFKTGALLLDGNTLNYFGKNIPINL  AV+AE+VL+GGA
Sbjct:    4 LGVSEMLGTPLNFRAVSRSSAPLASSPSTFKTVALFSKKKPAPAKSKAVSET---SDELAKWYGPDRRIFLPDGLLDRSEIPEYLNGEVAGDYGYDPFGLGKKPENFAKYQAFELIHARWAMLGAAGFIIPEALNKYGANCGPEAVWFKTGALLLDGNTLNYFGKNIPINLVLAVVAEVVLLGGA 185          
BLAST of BQ623113 vs. ExPASy Swiss-Prot
Match: CB2_DUNTE (Chlorophyll a-b binding protein of LHCII type I, chloroplastic OS=Dunaliella tertiolecta PE=2 SV=1)

HSP 1 Score: 108.997 bits (271), Expect = 2.076e-23
Identity = 56/126 (44.44%), Postives = 76/126 (60.32%), Query Frame = 1
Query:  256 KWYGPDRRIFLPEGLLDRSEIPEYLTGEVPGDYGYDPFGLSKKPDDFSKYQAYELIHARWAMLGAAGFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFGKNIPI---NLGFAVIAEIVLVG 624
            ++YGPDR  FL  G    ++ PEYLTGE PGDYG+D  GLS  P  F++Y+  ELIHARWA+LGA G + PE  +++      E VWFK GA +     LNY G    I   ++   +  ++VL+G
Sbjct:   32 EFYGPDRAKFL--GPFSENDTPEYLTGEFPGDYGWDTAGLSADPQTFARYREIELIHARWALLGALGILTPELLSQYAGVQFGEPVWFKAGAQIFADGGLNYLGNESLIHAQSIIATLAVQVVLMG 155          
BLAST of BQ623113 vs. ExPASy Swiss-Prot
Match: CB21_GOSHI (Chlorophyll a-b binding protein 151, chloroplastic OS=Gossypium hirsutum GN=CAB-151 PE=2 SV=2)

HSP 1 Score: 104.375 bits (259), Expect = 5.113e-22
Identity = 52/103 (50.49%), Postives = 64/103 (62.14%), Query Frame = 1
Query:  259 WYGPDRRIFLPEGLLDRSEIPEYLTGEVPGDYGYDPFGLSKKPDDFSKYQAYELIHARWAMLGAAGFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFG 567
            WYGPDR  +L        +IP YLTGE PGDYG+D  GLS  P+ F+K +  E+IH RWAMLGA G + PE  +K G   G EAVWFK G+ +     L+Y G
Sbjct:   49 WYGPDRPKYLGPF---SDQIPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEILSKNGVKFG-EAVWFKAGSQIFSEGGLDYLG 147          
BLAST of BQ623113 vs. ExPASy Swiss-Prot
Match: CB2B_PINSY (Chlorophyll a-b binding protein type 2 member 1B, chloroplastic OS=Pinus sylvestris PE=2 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 6.678e-22
Identity = 52/103 (50.49%), Postives = 64/103 (62.14%), Query Frame = 1
Query:  259 WYGPDRRIFLPEGLLDRSEIPEYLTGEVPGDYGYDPFGLSKKPDDFSKYQAYELIHARWAMLGAAGFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFG 567
            WYGPDR ++L        E P YLTGE PGDYG+D  GLS  P++F+K +  E+IH RWAMLGA G + PE   + G   G EAVWFK GA +     L+Y G
Sbjct:   58 WYGPDRVLYLGPF---SGEPPSYLTGEFPGDYGWDTAGLSADPENFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFG-EAVWFKAGAQIFSEGGLDYLG 156          
BLAST of BQ623113 vs. ExPASy Swiss-Prot
Match: CB2_CHLMO (Chlorophyll a-b binding protein of LHCII type I, chloroplastic OS=Chlamydomonas moewusii PE=2 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 8.722e-22
Identity = 54/126 (42.86%), Postives = 72/126 (57.14%), Query Frame = 1
Query:  256 KWYGPDRRIFLPEGLLDRSEIPEYLTGEVPGDYGYDPFGLSKKPDDFSKYQAYELIHARWAMLGAAGFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFGKNIPI---NLGFAVIAEIVLVG 624
            +WYGPDR  +L       +  P YLTGE PGDYG+D  GLS  P+ F KY+  E+IHARWA+LGA G + PE  + +      E VWFK GA +     L+Y G    I   N+   +  ++VL+G
Sbjct:   38 EWYGPDRAKWLGPF---STNTPAYLTGEFPGDYGWDTAGLSADPETFKKYRELEVIHARWALLGALGILTPELLSTYAGVKFGEPVWFKAGAQIFSEGGLDYLGSPALIHAQNIVATLAVQVVLMG 160          
BLAST of BQ623113 vs. ExPASy Swiss-Prot
Match: CB2A_PINSY (Chlorophyll a-b binding protein type 2 member 1A, chloroplastic OS=Pinus sylvestris PE=2 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 8.722e-22
Identity = 52/103 (50.49%), Postives = 64/103 (62.14%), Query Frame = 1
Query:  259 WYGPDRRIFLPEGLLDRSEIPEYLTGEVPGDYGYDPFGLSKKPDDFSKYQAYELIHARWAMLGAAGFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFG 567
            WYGPDR ++L        E P YLTGE PGDYG+D  GLS  P+ F+K +  E+IH+RWAMLGA G + PE   + G   G EAVWFK GA +     L+Y G
Sbjct:   62 WYGPDRVLYLGPF---SGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFG-EAVWFKAGAQIFSEGGLDYLG 160          
BLAST of BQ623113 vs. ExPASy Swiss-Prot
Match: CB29_MAIZE (Chlorophyll a-b binding protein M9, chloroplastic OS=Zea mays GN=CAB-M9 PE=2 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 8.722e-22
Identity = 53/103 (51.46%), Postives = 66/103 (64.08%), Query Frame = 1
Query:  259 WYGPDRRIFLPEGLLDRSEIPEYLTGEVPGDYGYDPFGLSKKPDDFSKYQAYELIHARWAMLGAAGFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFG 567
            WYGPDR ++L  G L   E P YLTGE PGDYG+D  GLS  P+ F+K +  E+IH+RWAMLGA G + PE   + G   G EAVWFK G+ +     L+Y G
Sbjct:   49 WYGPDRVLYL--GPLS-GEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFG-EAVWFKAGSQIFSEGGLDYLG 147          
BLAST of BQ623113 vs. ExPASy Swiss-Prot
Match: CB2A_PYRPY (Chlorophyll a-b binding protein 1A, chloroplastic OS=Pyrus pyrifolia PE=2 SV=1)

HSP 1 Score: 103.219 bits (256), Expect = 1.139e-21
Identity = 52/103 (50.49%), Postives = 64/103 (62.14%), Query Frame = 1
Query:  259 WYGPDRRIFLPEGLLDRSEIPEYLTGEVPGDYGYDPFGLSKKPDDFSKYQAYELIHARWAMLGAAGFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFG 567
            WYGPDR ++L        E P YLTGE PGDYG+D  GLS  P+ F+K +  E+IH+RWAMLGA G + PE   + G   G EAVWFK GA +     L+Y G
Sbjct:   62 WYGPDRVMYLGPF---SGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFG-EAVWFKAGAQIFSEGGLDYLG 160          
BLAST of BQ623113 vs. ExPASy Swiss-Prot
Match: CB28_PEA (Chlorophyll a-b binding protein 8, chloroplastic OS=Pisum sativum GN=CAB8 PE=1 SV=1)

HSP 1 Score: 103.219 bits (256), Expect = 1.139e-21
Identity = 52/103 (50.49%), Postives = 64/103 (62.14%), Query Frame = 1
Query:  259 WYGPDRRIFLPEGLLDRSEIPEYLTGEVPGDYGYDPFGLSKKPDDFSKYQAYELIHARWAMLGAAGFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFG 567
            WYGPDR  +L        E P YLTGE PGDYG+D  GLS  P+ FSK +  E+IH+RWAMLGA G + PE  ++ G   G EAVWFK G+ +     L+Y G
Sbjct:   52 WYGPDRVKYLGPF---SGESPSYLTGEFPGDYGWDTAGLSADPETFSKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFG-EAVWFKAGSQIFSEGGLDYLG 150          
BLAST of BQ623113 vs. ExPASy Swiss-Prot
Match: CB24_PETSP (Chlorophyll a-b binding protein 25, chloroplastic OS=Petunia sp. GN=CAB25 PE=3 SV=1)

HSP 1 Score: 103.219 bits (256), Expect = 1.139e-21
Identity = 52/103 (50.49%), Postives = 63/103 (61.17%), Query Frame = 1
Query:  259 WYGPDRRIFLPEGLLDRSEIPEYLTGEVPGDYGYDPFGLSKKPDDFSKYQAYELIHARWAMLGAAGFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFG 567
            WYGPDR  +L        E P YLTGE PGDYG+D  GLS  P+ F+K +  E+IH RWAMLGA G + PE F + G   G EAVWFK G+ +     L+Y G
Sbjct:   50 WYGPDRVKYLGPF---SGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELFARNGVKFG-EAVWFKAGSQIFSEGGLDYLG 148          
The following BLAST results are available for this feature:
BLAST of BQ623113 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 63
Match NameE-valueIdentityDescription
CB26_ARATH1.978e-7473.51Chlorophyll a-b binding protein CP26, chloroplasti... [more]
CB2_DUNTE2.076e-2344.44Chlorophyll a-b binding protein of LHCII type I, c... [more]
CB21_GOSHI5.113e-2250.49Chlorophyll a-b binding protein 151, chloroplastic... [more]
CB2B_PINSY6.678e-2250.49Chlorophyll a-b binding protein type 2 member 1B, ... [more]
CB2_CHLMO8.722e-2242.86Chlorophyll a-b binding protein of LHCII type I, c... [more]
CB2A_PINSY8.722e-2250.49Chlorophyll a-b binding protein type 2 member 1A, ... [more]
CB29_MAIZE8.722e-2251.46Chlorophyll a-b binding protein M9, chloroplastic ... [more]
CB2A_PYRPY1.139e-2150.49Chlorophyll a-b binding protein 1A, chloroplastic ... [more]
CB28_PEA1.139e-2150.49Chlorophyll a-b binding protein 8, chloroplastic O... [more]
CB24_PETSP1.139e-2150.49Chlorophyll a-b binding protein 25, chloroplastic ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00204 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00204 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623113 ID=BQ623113|Name=BQ623113|organism=Citrus sinensis|type=EST|length=630bp
CTAACACAAAGAAGCAGCAGCAGCAACACTCTGAAGATGGCTTCATTGGC
AGCATCGTCCACTCCTGCTGCCTCCATTGGAGCTAAGGAGATGCTTGGCA
ACCCTCTCAATGTCAGCAGTGCTGTTAGGACTTCAGCTCCAGGTGCATCA
AACCCTTCTACTTTCAAGCCCGTTGCTCTCTTCTCCAAGAAGAAAGCCGC
CCCTCCTGCCAAGTCTAAGCCCGTCGCCGTCTCCCCCGTTAACGAAGAGC
TCGCCAAGTGGTATGGTCCTGACCGAAGAATTTTCTTGCCCGAGGGTCTC
TTGGACAGATCTGAGATCCCTGAGTACTTGACCGGAGAAGTTCCCGGAGA
CTATGGTTACGATCCTTTTGGTCTCAGCAAGAAACCAGACGACTTCAGCA
AATATCAGGCATATGAATTGATTCATGCCAGATGGGCCATGCTTGGTGCT
GCTGGTTTCATCATTCCTGAAGCCTTTAACAAGTTTGGTGCTAACTGTGG
TCCTGAAGCTGTCTGGTTCAAGACTGGAGCTCTACTTCTTGATGGAAACA
CATTGAACTACTTCGGAAAGAACATCCCAATCAACCTTGGTTTTGCTGTC
ATTGCTGAAATTGTTCTTGTAGGTGGTGCT
back to top