BQ623122

Overview
NameBQ623122
Unique NameBQ623122
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length617
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of BQ623122 vs. ExPASy Swiss-Prot
Match: YCF36_PORPU (Uncharacterized protein ycf36 OS=Porphyra purpurea GN=ycf36 PE=3 SV=1)

HSP 1 Score: 107.457 bits (267), Expect = 5.732e-23
Identity = 53/122 (43.44%), Postives = 77/122 (63.11%), Query Frame = 2
Query:  251 VPSEQRPVNEYSSLKDGALYSWGELGQGPFILRLGGLWLVAFMVLGVPTAAASFDPSREPLRFVLAAGTGTLFLVSLIVLRIYLGWSYVGDRLLSAVIPYEESGWYDGQMWVKPPEVLARDR 616
            VP EQ+PVNEY+SLK+   + W  L    +  ++  + L+A   L  P   + F  ++ PL+F  +    +  +   I++R+YLGWSYV  RL+SA + YEESGWYDGQ+WVKP E+L +DR
Sbjct:   10 VPLEQQPVNEYNSLKNSWFFCWPTLSSHSYNKKIT-ITLIATCFLVSPVLLSIFPIAKLPLKFFFSEFIISSLITCFILIRLYLGWSYVVKRLMSATVFYEESGWYDGQIWVKPSEILVKDR 130          
BLAST of BQ623122 vs. ExPASy Swiss-Prot
Match: YCF36_PORYE (Uncharacterized protein ycf36 OS=Porphyra yezoensis GN=ycf36 PE=3 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 4.852e-22
Identity = 51/122 (41.80%), Postives = 78/122 (63.93%), Query Frame = 2
Query:  251 VPSEQRPVNEYSSLKDGALYSWGELGQGPFILRLGGLWLVAFMVLGVPTAAASFDPSREPLRFVLAAGTGTLFLVSLIVLRIYLGWSYVGDRLLSAVIPYEESGWYDGQMWVKPPEVLARDR 616
            VP EQ+PV+EY+SLK+   + W  L +  +  ++  + L+   +L  P   + F  ++ PL+F  +    +  +   I++R+YLGWSYV  RL+SA + YEESGWYDGQ+WVKP E+L +DR
Sbjct:   10 VPKEQQPVHEYTSLKNSWFFCWPTLSRRSYNKKIT-IALLLNCLLVSPILLSIFPITKLPLKFFFSEFITSSLMTGFILIRLYLGWSYVVKRLMSATVFYEESGWYDGQIWVKPSEILLKDR 130          
BLAST of BQ623122 vs. ExPASy Swiss-Prot
Match: YCF36_CYAPA (Uncharacterized protein ycf36 OS=Cyanophora paradoxa GN=ycf36 PE=3 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 6.558e-19
Identity = 48/122 (39.34%), Postives = 72/122 (59.02%), Query Frame = 2
Query:  251 VPSEQRPVNEYSSLKDGALYSWGELGQGPFILRLGGLWLVAFMVLGVPTAAASFDPSREPLRFVLAAGTGTLFLVSLIVLRIYLGWSYVGDRLLSAVIPYEESGWYDGQMWVKPPEVLARDR 616
            +P+EQ+P+NEY  L +  L++W       +   L  ++ + F++  + T          P+   +    G  F++ L +LR+YLGWSY+  RLLSA + YEESGWYDGQ+WVK  EVL +DR
Sbjct:    7 IPTEQQPLNEYQILNNSVLFNWPSQKLKIYFFYLFTIYSIGFLLTFLITFYNDLFIVH-PVNIFVHGIIGGNFVLILDLLRLYLGWSYICQRLLSATVSYEESGWYDGQIWVKSSEVLIQDR 127          
BLAST of BQ623122 vs. ExPASy Swiss-Prot
Match: YCF36_GUITH (Uncharacterized protein ycf36 OS=Guillardia theta GN=ycf36 PE=3 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 1.565e-12
Identity = 47/125 (37.60%), Postives = 68/125 (54.40%), Query Frame = 2
Query:  251 VPSEQRPVNEYSSLKDGALYSWG-ELGQ--GPFILRLGGLWLVAFMVLGVPTAAASFDPSREPLRFVLAAGTGTLFLVSLIVLRIYLGWSYVGDRLLSAVIPYEESGWYDGQMWVKPPEVLARDR 616
            VP  Q P+NEY+ L     +SW  ++G+    F+L++  L L  F  + +    + ++     L         TLF + LI LR YLG+ Y+  RLL + +PYEES WYDGQ+WVK    L +DR
Sbjct:    5 VPENQLPINEYNKLTSAWDFSWACKIGKLYYKFLLKMQ-LCLFLFFCICLNFLDSKYETGLYSLIL------STLF-ICLICLRTYLGFRYIYVRLLKSALPYEESSWYDGQVWVKNINYLIKDR 121          
The following BLAST results are available for this feature:
BLAST of BQ623122 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
YCF36_PORPU5.732e-2343.44Uncharacterized protein ycf36 OS=Porphyra purpurea... [more]
YCF36_PORYE4.852e-2241.80Uncharacterized protein ycf36 OS=Porphyra yezoensi... [more]
YCF36_CYAPA6.558e-1939.34Uncharacterized protein ycf36 OS=Cyanophora parado... [more]
YCF36_GUITH1.565e-1237.60Uncharacterized protein ycf36 OS=Guillardia theta ... [more]
back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00213 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00213 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623122 ID=BQ623122|Name=BQ623122|organism=Citrus sinensis|type=EST|length=617bp
AGTGGAATTAGTTCAGGTCTTAAGCTGCTGCAATTCCACAAAATAAATGA
TCAGACTAAATGCCTATTGCTCTACACTTCCGAGTGCAGCGCAAGTCAAG
CTTGGAAGCAGCTATGGTTCATTTATAATCAAGAACTACAAAGCTCGAAA
GTCATCCTGGGGGGTCTCTGTAAGGGCCTTAAAAGATGAAACAAATGGAG
GGACAAGCAGCTCTGCTGGCAGGAGTTGGGAACCTGGCTTGGAAATTGAG
GTGCCTTCTGAGCAAAGACCGGTGAACGAGTACTCTTCTCTGAAAGATGG
AGCTCTATACTCTTGGGGCGAACTGGGACAAGGGCCATTTATCCTTCGTC
TTGGGGGCCTTTGGCTAGTAGCTTTCATGGTTCTTGGAGTTCCAACTGCA
GCTGCAAGCTTTGATCCTTCAAGGGAACCCCTGAGATTTGTGCTAGCAGC
TGGAACAGGAACTCTTTTCCTTGTATCGTTAATCGTCTTACGGATATATC
TGGGATGGAGTTACGTTGGTGATAGACTTCTATCAGCAGTGATACCATAT
GAAGAAAGTGGATGGTATGATGGACAAATGTGGGTAAAGCCACCAGAGGT
CCTAGCTCGTGATAGAC
back to top