BQ623124
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of BQ623124 vs. ExPASy Swiss-Prot
Match: RCA_ARATH (Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic OS=Arabidopsis thaliana GN=RCA PE=1 SV=2) HSP 1 Score: 68.9366 bits (167), Expect = 8.908e-12 Identity = 29/38 (76.32%), Postives = 32/38 (84.21%), Query Frame = 2 Query: 35 GKAAQQVKVPVPEGCTDPAAANYDPTARSDDGSCNYQF 148 GK AQQV +PVPEGCTDP A N+DPTARSDDG+C Y F Sbjct: 437 GKGAQQVNLPVPEGCTDPVAENFDPTARSDDGTCVYNF 474
BLAST of BQ623124 vs. ExPASy Swiss-Prot
Match: RCA1_LARTR (Ribulose bisphosphate carboxylase/oxygenase activase 1, chloroplastic OS=Larrea tridentata GN=RCA1 PE=2 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 8.908e-12 Identity = 33/42 (78.57%), Postives = 35/42 (83.33%), Query Frame = 2 Query: 26 FDTGKAAQQV-KVPVPEGCTDPAAANYDPTARSDDGSCNYQF 148 F G+AAQQV VPVPEGCTDP A NYDPTARSDDGSC Y+F Sbjct: 435 FYGGQAAQQVGNVPVPEGCTDPQATNYDPTARSDDGSCVYKF 476
BLAST of BQ623124 vs. ExPASy Swiss-Prot
Match: RCA_SPIOL (Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic OS=Spinacia oleracea PE=1 SV=2) HSP 1 Score: 67.3958 bits (163), Expect = 2.592e-11 Identity = 29/36 (80.56%), Postives = 31/36 (86.11%), Query Frame = 2 Query: 35 GKAAQQVKVPVPEGCTDPAAANYDPTARSDDGSCNY 142 GKAAQQV +PV +GCTDP A NYDPTARSDDGSC Y Sbjct: 435 GKAAQQVSLPVAQGCTDPEAKNYDPTARSDDGSCTY 470 The following BLAST results are available for this feature:
BLAST of BQ623124 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 3
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >BQ623124 ID=BQ623124; Name=BQ623124; organism=Citrus sinensis; type=EST; length=329bpback to top |