BQ623125

Overview
NameBQ623125
Unique NameBQ623125
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length579
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5151 contig Csv1_Contig5151:1809..2386. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623125 vs. ExPASy Swiss-Prot
Match: SERA_ARATH (D-3-phosphoglycerate dehydrogenase, chloroplastic OS=Arabidopsis thaliana GN=At1g17745 PE=1 SV=2)

HSP 1 Score: 57.7658 bits (138), Expect = 8.707e-11
Identity = 28/34 (82.35%), Postives = 28/34 (82.35%), Query Frame = -2
Query:  477 NILGEHNVNVNFMSVGRTFRRNHGIMAIGVDEEP 578
            NILGE NVNVNFMSVGRT  R   IMAIGVDEEP
Sbjct:  569 NILGEQNVNVNFMSVGRTVLRKQAIMAIGVDEEP 602          

HSP 2 Score: 29.261 bits (64), Expect = 8.707e-11
Identity = 14/19 (73.68%), Postives = 16/19 (84.21%), Query Frame = -3
Query:  410 SLKEIGKVPAIEEFVFLKL 466
            +L+ IG V AIEEFVFLKL
Sbjct:  606 TLERIGGVSAIEEFVFLKL 624          
The following BLAST results are available for this feature:
BLAST of BQ623125 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
SERA_ARATH8.707e-1182.35D-3-phosphoglycerate dehydrogenase, chloroplastic ... [more]
back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00216 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00216 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623125 ID=BQ623125|Name=BQ623125|organism=Citrus sinensis|type=EST|length=579bp
ACAAATTGAAAGCTTTCCCTCTGCTCTATGGAAGCAAGCTTATACAAATA
CTGGCTAGAATTACGATTTATGAAAGGCTCATACAAACACCAATAGAAGC
ACTTAATCAGGTGCTACCAGCTTAAATAAAGTTTAAGCAATTTCTACACC
ATCAATTAAGGACGGTAACTAACACTTGACAATAAAAAAGACTATCACTA
TAGTTGAGTTCCAATCTAATGCGCGACTGCACACGTGGCGAGTGTTCATT
AGCAGGATTGTGGTCCCCACGATGTGGCTCCACCAATTATAAATCGCCAT
GCACGTAGTCGCACGCTATAAGATACGTGCAACAAAGTGTACCTAATCGA
AATCCATCACCGGTTACTCGATTCAGAAACCATATTATTTCAAACTCTTT
CATGAATCATAGTTTGAGGAATACAAACTCTTCAATTGCAGGCACCTTTC
CTATTTCCTTGAGGGAATCCTGATTTTGGTTCTTCATCAACGCCGATTGC
CATGATCCCATGATTCCTCCTGAAAGTTCTTCCTACACTCATGAAGTTCA
CATTGACATTATGCTCACCAAGTATGTTC
back to top