BQ623479
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of BQ623479 vs. ExPASy Swiss-Prot
Match: ATP5E_IPOBA (ATP synthase subunit epsilon, mitochondrial OS=Ipomoea batatas PE=1 SV=2) HSP 1 Score: 85.1149 bits (209), Expect = 6.131e-26 Identity = 37/43 (86.05%), Postives = 42/43 (97.67%), Query Frame = 2 Query: 47 MASNAAVPFWRAAGMTYISYSNICANLVRNCLKEPYKTEALTR 175 MASNAAVPFWRAAGMTYI+YSN+CAN+VRNCLKEPY+ EAL+R Sbjct: 1 MASNAAVPFWRAAGMTYITYSNLCANMVRNCLKEPYRAEALSR 43 HSP 2 Score: 52.7582 bits (125), Expect = 6.131e-26 Identity = 23/27 (85.19%), Postives = 23/27 (85.19%), Query Frame = 3 Query: 177 EKVHFSISKWTDGKPQKPTIRSDTPEE 257 EKVHFS SKW DGKPQKP IRSDT EE Sbjct: 44 EKVHFSFSKWVDGKPQKPAIRSDTGEE 70
BLAST of BQ623479 vs. ExPASy Swiss-Prot
Match: ATP5E_MAIZE (ATP synthase subunit epsilon, mitochondrial OS=Zea mays PE=3 SV=1) HSP 1 Score: 75.8702 bits (185), Expect = 1.784e-21 Identity = 34/42 (80.95%), Postives = 38/42 (90.48%), Query Frame = 2 Query: 50 ASNAAVPFWRAAGMTYISYSNICANLVRNCLKEPYKTEALTR 175 A+ AAVPFWRAAGMTYI YSNICA LVRNCLKEP+K+EA +R Sbjct: 3 ATTAAVPFWRAAGMTYIGYSNICAALVRNCLKEPFKSEAASR 44 HSP 2 Score: 46.9802 bits (110), Expect = 1.784e-21 Identity = 19/33 (57.58%), Postives = 26/33 (78.79%), Query Frame = 3 Query: 156 KPRPSLAEKVHFSISKWTDGKPQKPTIRSDTPE 254 K + EKVHFSISKWTDGK +KPT+R+++ + Sbjct: 38 KSEAASREKVHFSISKWTDGKQEKPTVRTESDD 70
BLAST of BQ623479 vs. ExPASy Swiss-Prot
Match: ATP5E_ARATH (ATP synthase subunit epsilon, mitochondrial OS=Arabidopsis thaliana GN=At1g51650 PE=1 SV=3) HSP 1 Score: 87.8113 bits (216), Expect = 3.479e-17 Identity = 40/43 (93.02%), Postives = 42/43 (97.67%), Query Frame = 2 Query: 47 MASNAAVPFWRAAGMTYISYSNICANLVRNCLKEPYKTEALTR 175 MASNAAVPFWRAAGMTYISYSNICAN+VRNCLKEP+K EALTR Sbjct: 1 MASNAAVPFWRAAGMTYISYSNICANIVRNCLKEPHKAEALTR 43 The following BLAST results are available for this feature:
BLAST of BQ623479 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 3
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >BQ623479 ID=BQ623479; Name=BQ623479; organism=Citrus sinensis; type=EST; length=533bpback to top |