CB304383

Overview
NameCB304383
Unique NameCB304383
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length305
Libraries
Library NameType
Flavedo Maturecdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5271 contig Csv1_Contig5271:584..888. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB304383 vs. ExPASy Swiss-Prot
Match: LEA5_CITSI (Late embryogenesis abundant protein Lea5 OS=Citrus sinensis GN=LEA5 PE=2 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 2.250e-15
Identity = 36/36 (100.00%), Postives = 36/36 (100.00%), Query Frame = -3
Query:  196 WAPDPITGYYRPENRAVEIDPAELREMLLNHKVRAH 303
            WAPDPITGYYRPENRAVEIDPAELREMLLNHKVRAH
Sbjct:   62 WAPDPITGYYRPENRAVEIDPAELREMLLNHKVRAH 97          
BLAST of CB304383 vs. ExPASy Swiss-Prot
Match: LEA5D_GOSHI (Late embryogenesis abundant protein Lea5-D OS=Gossypium hirsutum GN=LEA5-D PE=2 SV=1)

HSP 1 Score: 65.855 bits (159), Expect = 7.491e-11
Identity = 28/35 (80.00%), Postives = 31/35 (88.57%), Query Frame = -3
Query:  199 WAPDPITGYYRPENRAVEIDPAELREMLLNHKVRA 303
            WAPDP+TGYYRPEN   EID AELREMLLNH+VR+
Sbjct:   70 WAPDPVTGYYRPENCGAEIDAAELREMLLNHRVRS 104          
The following BLAST results are available for this feature:
BLAST of CB304383 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
LEA5_CITSI2.250e-15100.00Late embryogenesis abundant protein Lea5 OS=Citrus... [more]
LEA5D_GOSHI7.491e-1180.00Late embryogenesis abundant protein Lea5-D OS=Goss... [more]
back to top
Properties
Property NameValue
Genbank descriptionFLAVEDO0001_IIIaR_A08 Flavedo Mature Citrus sinensis cDNA clone FLAVEDO0001_IIIaR_A08 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB304383 ID=CB304383|Name=CB304383|organism=Citrus sinensis|type=EST|length=305bp
TTTTTTTTTTTTTTTTTTTTTTTTTTTTGCGACAAAATCATGGAAATGCA
CTATTAAAAGTTGTAAATAACAGTTGATATCAAAACAACAGCAAAGACTT
TAGAGTGAGTCAAAATTGCTACTGTAACAACATCACTTAAAAGTTAAAGC
ACCGCTAACAGCAAAGGATCTGCTGCTATGCGCGACCACTCCCTAGTGTG
CCCTGACTTTGTGGTTCAACAGCATCTCTCGAAGCTCTGCTGGATCAATC
TCGACCGCCCGATTCTCCGGCCTGTAGTACCCAGTGATGGGATCTGGGGC
CCAGG
back to top