CB304384

Overview
NameCB304384
Unique NameCB304384
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length279
Libraries
Library NameType
Flavedo Maturecdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig13836 contig Csv1_Contig13836:1..275. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB304384 vs. ExPASy Swiss-Prot
Match: LOX23_HORVU (Lipoxygenase 2.3, chloroplastic OS=Hordeum vulgare GN=LOX2.3 PE=1 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 5.163e-12
Identity = 31/43 (72.09%), Postives = 37/43 (86.05%), Query Frame = -2
Query:  147 ELEGIIDARNADPKLRNRNGAGMVPYELLKPFSEPGVTGKGVP 275
            E EG ID RN +P+ +NR GAG+VPYELLKPFSEPGVTG+G+P
Sbjct:  849 EAEGTIDMRNNNPENKNRCGAGIVPYELLKPFSEPGVTGRGIP 891          
BLAST of CB304384 vs. ExPASy Swiss-Prot
Match: LOXC2_ORYSJ (Probable lipoxygenase 8, chloroplastic OS=Oryza sativa subsp. japonica GN=CM-LOX2 PE=2 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 2.562e-11
Identity = 28/43 (65.12%), Postives = 37/43 (86.05%), Query Frame = -2
Query:  147 ELEGIIDARNADPKLRNRNGAGMVPYELLKPFSEPGVTGKGVP 275
            E+EG+ID RN D KL+NR GAG++PY+L+KPFS+ GVTG G+P
Sbjct:  894 EIEGVIDGRNKDRKLKNRCGAGILPYQLMKPFSDAGVTGMGIP 936          
BLAST of CB304384 vs. ExPASy Swiss-Prot
Match: LOXC1_ORYSJ (Lipoxygenase 7, chloroplastic OS=Oryza sativa subsp. japonica GN=CM-LOX1 PE=2 SV=2)

HSP 1 Score: 67.3958 bits (163), Expect = 2.562e-11
Identity = 28/43 (65.12%), Postives = 37/43 (86.05%), Query Frame = -2
Query:  147 ELEGIIDARNADPKLRNRNGAGMVPYELLKPFSEPGVTGKGVP 275
            E+EG+ID RN D KL+NR GAG++PY+L+KPFS+ GVTG G+P
Sbjct:  877 EIEGVIDGRNKDRKLKNRCGAGILPYQLMKPFSDSGVTGMGIP 919          
The following BLAST results are available for this feature:
BLAST of CB304384 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
LOX23_HORVU5.163e-1272.09Lipoxygenase 2.3, chloroplastic OS=Hordeum vulgare... [more]
LOXC2_ORYSJ2.562e-1165.12Probable lipoxygenase 8, chloroplastic OS=Oryza sa... [more]
LOXC1_ORYSJ2.562e-1165.12Lipoxygenase 7, chloroplastic OS=Oryza sativa subs... [more]
back to top
Properties
Property NameValue
Genbank descriptionFLAVEDO0001_IIIaR_A09 Flavedo Mature Citrus sinensis cDNA clone FLAVEDO0001_IIIaR_A09 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB304384 ID=CB304384|Name=CB304384|organism=Citrus sinensis|type=EST|length=279bp
TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTGCAACATTAACTGCAATTT
ATTTGATTCATTCTTGAACTCATTCTCAAAAGTTTTTATTGATACAACAT
TCGAGCGATTGCAACAACATTTTCAACTCTAGATAGAGATGCTGTACGGA
ACTCCTTTTCCTGTAACACCAGGTTCCGAAAATGGCTTCAAGAGCTCATA
TGGCACCATCCCAGCTCCATTTCTATTCCTCAACTTGGGATCTGCATTCC
TTGCATCAATAATCCCTTCAAGCTCCATT
back to top