CB304455

Overview
NameCB304455
Unique NameCB304455
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length535
Libraries
Library NameType
Flavedo Maturecdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CB304455 vs. ExPASy Swiss-Prot
Match: TRPA_MAIZE (Indole-3-glycerol phosphate lyase, chloroplastic OS=Zea mays GN=BX1 PE=1 SV=2)

HSP 1 Score: 123.635 bits (309), Expect = 5.806e-28
Identity = 57/90 (63.33%), Postives = 78/90 (86.67%), Query Frame = -1
Query:  266 VSSIGVTGARASISGHVQTLLREIKESTTKPVAVGFGISKPEHVQQVAGWGADGVIVGSAMVKLLGEAQSPEEGLKELEKFAKSLKSALP 535
            VS  GVTG RA+++  V++L++E+K+ T KPVAVGFGISKPEHV+Q+A WGADGVI+GSAMV+ LGEA SP++GL+ LE++A+ +K+ALP
Sbjct:  258 VSVNGVTGPRANVNPRVESLIQEVKKVTNKPVAVGFGISKPEHVKQIAQWGADGVIIGSAMVRQLGEAASPKQGLRRLEEYARGMKNALP 347          
BLAST of CB304455 vs. ExPASy Swiss-Prot
Match: TRPA_CYAP8 (Tryptophan synthase alpha chain OS=Cyanothece sp. (strain PCC 8801) GN=trpA PE=3 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 4.030e-21
Identity = 52/93 (55.91%), Postives = 64/93 (68.82%), Query Frame = -1
Query:  257 VSSIGVTGARASISGHVQTLLREIKESTTKPVAVGFGISKPEHVQQVAGWGADGVIVGSAMVKLLGEAQSPEEGLKELEKFAKSLKSALP*EQ 535
            VS  GVTG R+ ++  V+ LL  ++ +T KP+ VGFGISKPEH  QV  WGAD VIVGSAMVK L E  +PEEGLK +  F + LK AL  +Q
Sbjct:  176 VSVTGVTGMRSQVTSRVKELLTSLRSATDKPIGVGFGISKPEHALQVKNWGADAVIVGSAMVKRLAEG-TPEEGLKAIGAFCQDLKQALKEDQ 267          
BLAST of CB304455 vs. ExPASy Swiss-Prot
Match: TRPA_CYAP4 (Tryptophan synthase alpha chain OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=trpA PE=3 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 2.612e-20
Identity = 49/89 (55.06%), Postives = 63/89 (70.79%), Query Frame = -1
Query:  269 VSSIGVTGARASISGHVQTLLREIKESTTKPVAVGFGISKPEHVQQVAGWGADGVIVGSAMVKLLGEAQSPEEGLKELEKFAKSLKSAL 535
            VS+ GVTG R+ + G V  LL E+++ T KP+ VGFGIS+PEH +QV  WGAD  IVGSA VK L E  +PE+GL  +  F +SLK+AL
Sbjct:  176 VSTTGVTGMRSKVEGRVHELLLELQQVTDKPIGVGFGISQPEHARQVMEWGADAAIVGSAFVKRLAEG-TPEQGLAAIADFCRSLKTAL 263          
BLAST of CB304455 vs. ExPASy Swiss-Prot
Match: TRPA_SYNY3 (Tryptophan synthase alpha chain OS=Synechocystis sp. (strain PCC 6803) GN=trpA PE=3 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 1.693e-19
Identity = 48/89 (53.93%), Postives = 61/89 (68.54%), Query Frame = -1
Query:  269 VSSIGVTGARASISGHVQTLLREIKESTTKPVAVGFGISKPEHVQQVAGWGADGVIVGSAMVKLLGEAQSPEEGLKELEKFAKSLKSAL 535
            VS  GVTG R  +   V+ LL  +++ T KP+ VGFGIS+PE  +QV  WGAD VIVGSAMVK L E  +P EGL+ LE F + LK+A+
Sbjct:  176 VSVTGVTGVRTEVGSRVEALLAGMRQVTDKPIGVGFGISQPEQAEQVKAWGADAVIVGSAMVKRLAEG-TPTEGLQALETFCRELKTAI 263          
BLAST of CB304455 vs. ExPASy Swiss-Prot
Match: TRPA_MICAN (Tryptophan synthase alpha chain OS=Microcystis aeruginosa (strain NIES-843) GN=trpA PE=3 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 3.772e-19
Identity = 50/89 (56.18%), Postives = 60/89 (67.42%), Query Frame = -1
Query:  269 VSSIGVTGARASISGHVQTLLREIKESTTKPVAVGFGISKPEHVQQVAGWGADGVIVGSAMVKLLGEAQSPEEGLKELEKFAKSLKSAL 535
            VS  GVTG R  ++  V+ LL  I+  T KPV VGFGIS+P    QV  WGAD VIVGSAMVK L +  SP +GLK LE+F +SLK A+
Sbjct:  176 VSVTGVTGMRKQVATRVEELLDSIRSVTDKPVGVGFGISEPTQALQVKNWGADAVIVGSAMVKRLAD-NSPSDGLKSLEEFCRSLKQAI 263          
BLAST of CB304455 vs. ExPASy Swiss-Prot
Match: TRPA_TRIEI (Tryptophan synthase alpha chain OS=Trichodesmium erythraeum (strain IMS101) GN=trpA PE=3 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 6.434e-19
Identity = 48/89 (53.93%), Postives = 64/89 (71.91%), Query Frame = -1
Query:  269 VSSIGVTGARASISGHVQTLLREIKESTTKPVAVGFGISKPEHVQQVAGWGADGVIVGSAMVKLLGEAQSPEEGLKELEKFAKSLKSAL 535
            VS  GVTG RA +   V+ LL +++E T KP+ VGFGIS+PE   QV  WG+D VIVGSA+VK L E  SP+EGLK + +F ++LK+A+
Sbjct:  177 VSVTGVTGMRAQMQTRVEDLLAQMREVTDKPIGVGFGISQPEQALQVKKWGSDAVIVGSAVVKRLAEG-SPDEGLKAIGEFCQNLKAAI 264          
BLAST of CB304455 vs. ExPASy Swiss-Prot
Match: TRPA_CYAA5 (Tryptophan synthase alpha chain OS=Cyanothece sp. (strain ATCC 51142) GN=trpA PE=3 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 6.434e-19
Identity = 46/89 (51.69%), Postives = 62/89 (69.66%), Query Frame = -1
Query:  269 VSSIGVTGARASISGHVQTLLREIKESTTKPVAVGFGISKPEHVQQVAGWGADGVIVGSAMVKLLGEAQSPEEGLKELEKFAKSLKSAL 535
            VS  GVTG R  ++  V+ LL+ ++ +T KP+ VGFGIS+PEH  QV  WG+D VIVGSA VK L +  +PEEGLK + +F + LK A+
Sbjct:  176 VSVTGVTGMRTQVATRVEDLLKSLRNTTDKPIGVGFGISEPEHALQVKNWGSDAVIVGSACVKRLAQG-TPEEGLKAVGEFCQRLKQAI 263          
BLAST of CB304455 vs. ExPASy Swiss-Prot
Match: TRPA_GLOVI (Tryptophan synthase alpha chain OS=Gloeobacter violaceus GN=trpA PE=3 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 1.872e-18
Identity = 49/88 (55.68%), Postives = 63/88 (71.59%), Query Frame = -1
Query:  272 VSSIGVTGARASISGHVQTLLREIKESTTKPVAVGFGISKPEHVQQVAGWGADGVIVGSAMVKLLGEAQSPEEGLKELEKFAKSLKSA 535
            VS+ GVTGAR  ++  V+T L +++  TT+PVAVGFGIS PE   +VA  GADGVIVGSA V+LL  A +PEE L +L +F + LK A
Sbjct:  182 VSTTGVTGARTQVASSVRTSLAQLRALTTRPVAVGFGISTPEQAHEVASLGADGVIVGSACVQLLATA-APEERLGQLAEFCRQLKKA 268          
BLAST of CB304455 vs. ExPASy Swiss-Prot
Match: TRPA_ACAM1 (Tryptophan synthase alpha chain OS=Acaryochloris marina (strain MBIC 11017) GN=trpA PE=3 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 1.872e-18
Identity = 45/89 (50.56%), Postives = 59/89 (66.29%), Query Frame = -1
Query:  269 VSSIGVTGARASISGHVQTLLREIKESTTKPVAVGFGISKPEHVQQVAGWGADGVIVGSAMVKLLGEAQSPEEGLKELEKFAKSLKSAL 535
            VS+ GVTG R  +   VQ L+ ++++ T KP+ VGFGIS+ EH +QV  WGAD  IVGSA V  L E  SP +GL  +  F +SLKS+L
Sbjct:  176 VSTTGVTGMRTKVENRVQDLIADLRQVTDKPIGVGFGISRTEHARQVMDWGADAAIVGSAFVNRLSEG-SPSQGLSAISTFCRSLKSSL 263          
BLAST of CB304455 vs. ExPASy Swiss-Prot
Match: TRPA_THEEB (Tryptophan synthase alpha chain OS=Thermosynechococcus elongatus (strain BP-1) GN=trpA PE=3 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 4.171e-18
Identity = 45/89 (50.56%), Postives = 61/89 (68.54%), Query Frame = -1
Query:  269 VSSIGVTGARASISGHVQTLLREIKESTTKPVAVGFGISKPEHVQQVAGWGADGVIVGSAMVKLLGEAQSPEEGLKELEKFAKSLKSAL 535
            VS+ GVTG R  ++  VQ LL  +++ T KP+ VGFGI+ PEH +QV  WGAD  IVGSA VK L E   P++GL  + +F +SL++AL
Sbjct:  178 VSTTGVTGMRQEMASRVQELLHTLRQITPKPIGVGFGIASPEHARQVRDWGADAAIVGSAFVKRLAE---PDQGLAAVAEFCQSLRTAL 263          
The following BLAST results are available for this feature:
BLAST of CB304455 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 48
Match NameE-valueIdentityDescription
TRPA_MAIZE5.806e-2863.33Indole-3-glycerol phosphate lyase, chloroplastic O... [more]
TRPA_CYAP84.030e-2155.91Tryptophan synthase alpha chain OS=Cyanothece sp. ... [more]
TRPA_CYAP42.612e-2055.06Tryptophan synthase alpha chain OS=Cyanothece sp. ... [more]
TRPA_SYNY31.693e-1953.93Tryptophan synthase alpha chain OS=Synechocystis s... [more]
TRPA_MICAN3.772e-1956.18Tryptophan synthase alpha chain OS=Microcystis aer... [more]
TRPA_TRIEI6.434e-1953.93Tryptophan synthase alpha chain OS=Trichodesmium e... [more]
TRPA_CYAA56.434e-1951.69Tryptophan synthase alpha chain OS=Cyanothece sp. ... [more]
TRPA_GLOVI1.872e-1855.68Tryptophan synthase alpha chain OS=Gloeobacter vio... [more]
TRPA_ACAM11.872e-1850.56Tryptophan synthase alpha chain OS=Acaryochloris m... [more]
TRPA_THEEB4.171e-1850.56Tryptophan synthase alpha chain OS=Thermosynechoco... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionFLAVEDO0001_IIaR_B01 Flavedo Mature Citrus sinensis cDNA clone FLAVEDO0001_IIaR_B01 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB304455 ID=CB304455|Name=CB304455|organism=Citrus sinensis|type=EST|length=535bp
TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTGCACCAAGTTTTGCCATTAT
TTGAATATAGAATCCATCTTGCAAGGACTTGCAGAGTAAGCATTACACAA
TCTCCAAATCAGGATTTGGAGAATAGATTCTCTAATTTTATACTACATAT
TCAACTTTAGCATCAGGAAATACAGTTCTTTTTAAAATTTGATTCTCTAA
ATAGAAAATTGTTTTTAGAAGTACACTTGATCAAACATTATTGCTGATCT
ACATTACTGTTCTCACGGGAGAGCAGATTTTAACGATTTTGCGAATTTTT
CTAGCTCCTTCAGTCCCTCCTCAGGAGATTGTGCTTCACCCAATAGCTTC
ACCATAGCACTCCCAACAATCACACCATCAGCTCCCCATCCTGCTACTTG
TTGCACATGCTCAGGTTTTGATATGCCAAAGCCAACTGCAACGGGCTTAG
TTGTTGACTCTTTAATTTCCCTTAAAAGAGTTTGAACATGGCCACTAATA
GAAGCGCGAGCTCCAGTAACTCCAATTGAGCTTAC
back to top