CB304457

Overview
NameCB304457
Unique NameCB304457
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length549
Libraries
Library NameType
Flavedo Maturecdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2850 contig Csv1_Contig2850:348..896. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB304457 vs. ExPASy Swiss-Prot
Match: IF5A3_SOLLC (Eukaryotic translation initiation factor 5A-3 OS=Solanum lycopersicum PE=2 SV=1)

HSP 1 Score: 150.984 bits (380), Expect = 3.578e-36
Identity = 73/81 (90.12%), Postives = 75/81 (92.59%), Query Frame = -1
Query:  307 HNCDVPHVTRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDENLLSQIRDGFESGKDLVVSVQCAMGEEQINALKDIGPK 549
            HNCDVPHV RTDYQLIDISEDGFVSLLT+NGNTKDDLRLPTDENLLS I+DGF  GKDLVVSV  AMGEEQINALKDIGPK
Sbjct:   79 HNCDVPHVNRTDYQLIDISEDGFVSLLTDNGNTKDDLRLPTDENLLSLIKDGFAEGKDLVVSVMSAMGEEQINALKDIGPK 159          
BLAST of CB304457 vs. ExPASy Swiss-Prot
Match: IF5A4_SOLTU (Eukaryotic translation initiation factor 5A-4 OS=Solanum tuberosum GN=EIF5A4 PE=2 SV=1)

HSP 1 Score: 150.599 bits (379), Expect = 4.673e-36
Identity = 72/81 (88.89%), Postives = 76/81 (93.83%), Query Frame = -1
Query:  307 HNCDVPHVTRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDENLLSQIRDGFESGKDLVVSVQCAMGEEQINALKDIGPK 549
            HNCDVPHV RTDYQLIDISEDGFVSLLT+NGNTKDDLRLPTD++LLSQI+DGF  GKDLVVSV  AMGEEQINALKDIGPK
Sbjct:   79 HNCDVPHVNRTDYQLIDISEDGFVSLLTDNGNTKDDLRLPTDDSLLSQIKDGFAEGKDLVVSVMSAMGEEQINALKDIGPK 159          
BLAST of CB304457 vs. ExPASy Swiss-Prot
Match: IF5A2_NICPL (Eukaryotic translation initiation factor 5A-2 OS=Nicotiana plumbaginifolia GN=EIF-5A2 PE=2 SV=1)

HSP 1 Score: 149.058 bits (375), Expect = 1.360e-35
Identity = 72/81 (88.89%), Postives = 75/81 (92.59%), Query Frame = -1
Query:  307 HNCDVPHVTRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDENLLSQIRDGFESGKDLVVSVQCAMGEEQINALKDIGPK 549
            HNCDVPHV RTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD+NLL+QI+DGF  GKDLVVSV  AMGEEQI ALKDIGPK
Sbjct:   79 HNCDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDDNLLTQIKDGFAEGKDLVVSVMSAMGEEQICALKDIGPK 159          
BLAST of CB304457 vs. ExPASy Swiss-Prot
Match: IF5A2_SOLLC (Eukaryotic translation initiation factor 5A-2 OS=Solanum lycopersicum PE=2 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 3.956e-35
Identity = 69/81 (85.19%), Postives = 75/81 (92.59%), Query Frame = -1
Query:  307 HNCDVPHVTRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDENLLSQIRDGFESGKDLVVSVQCAMGEEQINALKDIGPK 549
            HNCDVPHV RTDYQLIDISEDGFVSLLTE+GNTKDDLRLPTDENLL Q++DGF+ GKDLVVSV  AMGEEQINA+KD+G K
Sbjct:   79 HNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTDENLLKQVKDGFQEGKDLVVSVMSAMGEEQINAVKDVGTK 159          
BLAST of CB304457 vs. ExPASy Swiss-Prot
Match: IF5A_MANES (Eukaryotic translation initiation factor 5A OS=Manihot esculenta PE=2 SV=2)

HSP 1 Score: 146.362 bits (368), Expect = 8.813e-35
Identity = 71/81 (87.65%), Postives = 74/81 (91.36%), Query Frame = -1
Query:  307 HNCDVPHVTRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDENLLSQIRDGFESGKDLVVSVQCAMGEEQINALKDIGPK 549
            HNCDVPHV RTDYQLIDISEDGFVSLLTE GNTKDDLRLPTDENLLSQI+DGF  GKDLVVSV  AMGEE+I +LKDIGPK
Sbjct:   79 HNCDVPHVNRTDYQLIDISEDGFVSLLTETGNTKDDLRLPTDENLLSQIKDGFAEGKDLVVSVMSAMGEERICSLKDIGPK 159          
BLAST of CB304457 vs. ExPASy Swiss-Prot
Match: IF5A3_SOLTU (Eukaryotic translation initiation factor 5A-3 OS=Solanum tuberosum GN=EIF5A3 PE=2 SV=1)

HSP 1 Score: 146.362 bits (368), Expect = 8.813e-35
Identity = 69/81 (85.19%), Postives = 75/81 (92.59%), Query Frame = -1
Query:  307 HNCDVPHVTRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDENLLSQIRDGFESGKDLVVSVQCAMGEEQINALKDIGPK 549
            HNCDVPHV RTDYQLIDISEDGFVSLLTE+GNTKDDLRLPTDE+LL Q++DGF+ GKDLVVSV  AMGEEQINA+KDIG K
Sbjct:   79 HNCDVPHVNRTDYQLIDISEDGFVSLLTESGNTKDDLRLPTDESLLKQVKDGFQEGKDLVVSVMSAMGEEQINAIKDIGTK 159          
BLAST of CB304457 vs. ExPASy Swiss-Prot
Match: IF5A_SENVE (Eukaryotic translation initiation factor 5A OS=Senecio vernalis GN=EIFSV1 PE=2 SV=1)

HSP 1 Score: 144.436 bits (363), Expect = 3.349e-34
Identity = 70/81 (86.42%), Postives = 74/81 (91.36%), Query Frame = -1
Query:  307 HNCDVPHVTRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDENLLSQIRDGFESGKDLVVSVQCAMGEEQINALKDIGPK 549
            HNCDVPHV RTDYQLIDISEDGFVSLLTENGNTKDDL+LPTD+ LL+QI+DGF  GKDLVVSV  AMGEEQI ALKDIGPK
Sbjct:   79 HNCDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLKLPTDDALLTQIKDGFGEGKDLVVSVMSAMGEEQICALKDIGPK 159          
BLAST of CB304457 vs. ExPASy Swiss-Prot
Match: IF5A_MAIZE (Eukaryotic translation initiation factor 5A OS=Zea mays GN=TIF5A PE=1 SV=2)

HSP 1 Score: 143.665 bits (361), Expect = 5.712e-34
Identity = 67/81 (82.72%), Postives = 76/81 (93.83%), Query Frame = -1
Query:  307 HNCDVPHVTRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDENLLSQIRDGFESGKDLVVSVQCAMGEEQINALKDIGPK 549
            HNCD+PHV RT+YQLIDISEDGFVSLLT +GNTKDDLRLPTDE L++QI++GFESGKDLVV+VQ AMGEEQI ALKD+GPK
Sbjct:   80 HNCDIPHVNRTEYQLIDISEDGFVSLLTSDGNTKDDLRLPTDETLVAQIKEGFESGKDLVVTVQSAMGEEQICALKDVGPK 160          
BLAST of CB304457 vs. ExPASy Swiss-Prot
Match: IF5A5_SOLTU (Eukaryotic translation initiation factor 5A-5 OS=Solanum tuberosum GN=EIF5A5 PE=2 SV=1)

HSP 1 Score: 142.895 bits (359), Expect = 9.744e-34
Identity = 67/81 (82.72%), Postives = 73/81 (90.12%), Query Frame = -1
Query:  307 HNCDVPHVTRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDENLLSQIRDGFESGKDLVVSVQCAMGEEQINALKDIGPK 549
            HNCDVPHV RTDYQLIDISEDGFVSLLTENGNTKDDLRLPTD+ LL+Q++DGF  GKDLV+SV  AMGEEQI  +KDIGPK
Sbjct:   79 HNCDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDDTLLAQVKDGFAEGKDLVLSVMSAMGEEQICGIKDIGPK 159          
BLAST of CB304457 vs. ExPASy Swiss-Prot
Match: IF5A2_MEDSA (Eukaryotic translation initiation factor 5A-2 OS=Medicago sativa PE=2 SV=1)

HSP 1 Score: 142.895 bits (359), Expect = 9.744e-34
Identity = 68/81 (83.95%), Postives = 75/81 (92.59%), Query Frame = -1
Query:  307 HNCDVPHVTRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDENLLSQIRDGFESGKDLVVSVQCAMGEEQINALKDIGPK 549
            HNCDVPHV RTDYQLIDISEDGFVSLLT+NG+TKDDL+LPTD++LL+QI+DGF  GKDLVVSV  AMGEEQI ALKDIGPK
Sbjct:   79 HNCDVPHVNRTDYQLIDISEDGFVSLLTDNGSTKDDLKLPTDDSLLTQIKDGFADGKDLVVSVMSAMGEEQICALKDIGPK 159          
The following BLAST results are available for this feature:
BLAST of CB304457 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 33
Match NameE-valueIdentityDescription
IF5A3_SOLLC3.578e-3690.12Eukaryotic translation initiation factor 5A-3 OS=S... [more]
IF5A4_SOLTU4.673e-3688.89Eukaryotic translation initiation factor 5A-4 OS=S... [more]
IF5A2_NICPL1.360e-3588.89Eukaryotic translation initiation factor 5A-2 OS=N... [more]
IF5A2_SOLLC3.956e-3585.19Eukaryotic translation initiation factor 5A-2 OS=S... [more]
IF5A_MANES8.813e-3587.65Eukaryotic translation initiation factor 5A OS=Man... [more]
IF5A3_SOLTU8.813e-3585.19Eukaryotic translation initiation factor 5A-3 OS=S... [more]
IF5A_SENVE3.349e-3486.42Eukaryotic translation initiation factor 5A OS=Sen... [more]
IF5A_MAIZE5.712e-3482.72Eukaryotic translation initiation factor 5A OS=Zea... [more]
IF5A5_SOLTU9.744e-3482.72Eukaryotic translation initiation factor 5A-5 OS=S... [more]
IF5A2_MEDSA9.744e-3483.95Eukaryotic translation initiation factor 5A-2 OS=M... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionFLAVEDO0001_IIaR_B03 Flavedo Mature Citrus sinensis cDNA clone FLAVEDO0001_IIaR_B03 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB304457 ID=CB304457|Name=CB304457|organism=Citrus sinensis|type=EST|length=549bp
TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTAGCATGTTTGAAACAACCAA
AAGGTGCTTCGAAGTGTATATACAGTCACGTTGGCGGATACAACTTCTGC
ACACCGAGAACAACCATGTTTCAACTTTCAAGCAATCAAACAGAATAAAA
ATATTGTCGATAGAAAACAATTAATAATATGGTAAGAGTCATTTTATATG
AAATGATGACATTCATCTTGAAACCGGACACCAGTAAGCTACACTACTAT
CCACCTTCCCACAGCTTTCAGCAATCTGCATTCTCGATCAAGCAAAAAGT
CTTTTACTTGGGGCCAATGTCCTTCAGGGCATTGATCTGCTCCTCTCCCA
TAGCACACTGAACTGAGACAACCAGATCTTTCCCACTCTCAAATCCATCC
CTGATCTGTGAAAGAAGATTTTCATCAGTTGGAAGTCTCAGGTCATCCTT
GGTATTGCCATTCTCAGTCAGCAGGCTAACAAATCCATCCTCAGAGATAT
CAATCAGCTGGTAGTCAGTGCGAGTGACATGAGGAACATCACAGTTGTG
back to top