CB304463

Overview
NameCB304463
Unique NameCB304463
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length560
Libraries
Library NameType
Flavedo Maturecdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CB304463_ssr141 microsatellite CB304463_ssr141:141..155. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig5299 contig Csv1_Contig5299:471..1029. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB304463 vs. ExPASy Swiss-Prot
Match: CNGC2_ARATH (Cyclic nucleotide-gated ion channel 2 OS=Arabidopsis thaliana GN=CNGC2 PE=1 SV=1)

HSP 1 Score: 183.341 bits (464), Expect = 6.773e-46
Identity = 91/120 (75.83%), Postives = 100/120 (83.33%), Query Frame = -2
Query:  200 LRRPFIDRLPASSATFFCMESIEAFGLDAKNLRYITDHFRYKFANERLKRTARYYSSNWRTWAAVNIQFAWRRYRMRTRGPVIS-----VTENG-EGNESNRLMRYAAMFMSIRPHDHLE 541
            LRRPF+DRLP SSATF C+E+IEAF L +++LRYITDHFRYKFANERLKRTARYYSSNWRTWAAVNIQ AWRR R RTRG  I      V+EN  EGN   RL++YAAMFMSIRPHDHLE
Sbjct:  607 LRRPFLDRLPPSSATFVCLENIEAFSLGSEDLRYITDHFRYKFANERLKRTARYYSSNWRTWAAVNIQMAWRRRRKRTRGENIGGSMSPVSENSIEGNSERRLLQYAAMFMSIRPHDHLE 726          
BLAST of CB304463 vs. ExPASy Swiss-Prot
Match: CNGC4_ARATH (Cyclic nucleotide-gated ion channel 4 OS=Arabidopsis thaliana GN=CNGC4 PE=2 SV=2)

HSP 1 Score: 120.553 bits (301), Expect = 5.391e-27
Identity = 59/120 (49.17%), Postives = 81/120 (67.50%), Query Frame = -2
Query:  212 LRRPFIDRLPASSATFFCMESIEAFGLDAKNLRYITDHFRYKFANERLKRTARYYSSNWRTWAAVNIQFAWRRYR----------MRTRGPVISVTENGEGNESNRLMRYAAMFMSIRPH 541
            LRRPF++RLP SS+T   +E+ EAFGLDA++++Y+T HFRY F NE++KR+ARYYS  WRTWAAV +Q AWRRY+          +R R P+      GE    ++L  YAA+  S +P+
Sbjct:  572 LRRPFVERLPPSSSTLVTLETTEAFGLDAEDVKYVTQHFRYTFVNEKVKRSARYYSPGWRTWAAVAVQLAWRRYKHRLTLTSLSFIRPRRPLSRCASLGE----DKLRLYAAILTSPKPN 687          
BLAST of CB304463 vs. ExPASy Swiss-Prot
Match: CNG14_ARATH (Probable cyclic nucleotide-gated ion channel 14 OS=Arabidopsis thaliana GN=CNGC14 PE=2 SV=2)

HSP 1 Score: 75.0998 bits (183), Expect = 2.598e-13
Identity = 35/94 (37.23%), Postives = 57/94 (60.64%), Query Frame = -2
Query:  236 LPASSATFFCMESIEAFGLDAKNLRYITDHFRYKFANERLKRTARYYSSNWRTWAAVNIQFAWRRYRMRTRGPVISVTENGEGNESNRLMRYAA 517
            LP+S+ T   +E +EAF L A +L+++ + FR +  +++L+ T RYYS  WRTWAA  +Q AWRRY+ +     +S+ E+    +    +  AA
Sbjct:  567 LPSSTRTVRALEEVEAFALQAGDLKFVANQFR-RLHSKKLQHTFRYYSHQWRTWAACFVQVAWRRYKRKKLAKSLSLAESFSSYDEEEAVAVAA 659          
BLAST of CB304463 vs. ExPASy Swiss-Prot
Match: CNG17_ARATH (Probable cyclic nucleotide-gated ion channel 17 OS=Arabidopsis thaliana GN=CNGC17 PE=2 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 2.872e-12
Identity = 34/85 (40.00%), Postives = 55/85 (64.71%), Query Frame = -2
Query:  263 LPASSATFFCMESIEAFGLDAKNLRYITDHFRYKFANERLKRTARYYSSNWRTWAAVNIQFAWRRYRMRTRGPVISVTENGEGNE 517
            LP+S+ T   +  +EAF L A++L+++ + FR +  +++L+ T R+YS +WRTWAA  IQ AWRRY+ R     ++  E+ E  E
Sbjct:  567 LPSSTRTVRALVEVEAFALRAEDLKFVANQFR-RLHSKKLQHTFRFYSHHWRTWAACFIQAAWRRYKRRVMENNLTAIESMENEE 650          
BLAST of CB304463 vs. ExPASy Swiss-Prot
Match: CNGC7_ARATH (Putative cyclic nucleotide-gated ion channel 7 OS=Arabidopsis thaliana GN=CNGC7 PE=2 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 3.175e-11
Identity = 31/82 (37.80%), Postives = 50/82 (60.98%), Query Frame = -2
Query:  272 LPASSATFFCMESIEAFGLDAKNLRYITDHFRYKFANERLKRTARYYSSNWRTWAAVNIQFAWRRYRMRTRGPVISVTENGE 517
            LP+S+ T   +  +EAF L+A+ L+++   FR +  + ++++T R+YS  WRTWA+  IQ AWRRY  R    +  + E  E
Sbjct:  588 LPSSTRTVKALTEVEAFALEAEELKFVASQFR-RLHSRQVQQTFRFYSQQWRTWASCFIQAAWRRYSRRKNAELRRIEEKEE 668          
The following BLAST results are available for this feature:
BLAST of CB304463 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 5
Match NameE-valueIdentityDescription
CNGC2_ARATH6.773e-4675.83Cyclic nucleotide-gated ion channel 2 OS=Arabidops... [more]
CNGC4_ARATH5.391e-2749.17Cyclic nucleotide-gated ion channel 4 OS=Arabidops... [more]
CNG14_ARATH2.598e-1337.23Probable cyclic nucleotide-gated ion channel 14 OS... [more]
CNG17_ARATH2.872e-1240.00Probable cyclic nucleotide-gated ion channel 17 OS... [more]
CNGC7_ARATH3.175e-1137.80Putative cyclic nucleotide-gated ion channel 7 OS=... [more]
back to top
Properties
Property NameValue
Genbank descriptionFLAVEDO0001_IIaR_B11 Flavedo Mature Citrus sinensis cDNA clone FLAVEDO0001_IIaR_B11 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB304463 ID=CB304463|Name=CB304463|organism=Citrus sinensis|type=EST|length=560bp
TTTTTTTTTTTTTTTTTTTTTTTTTTTTACGCTAGCAAAAACCTGAAGTA
GGAAAGAATTTCCCCCCCTTTTTCTTTTATTTCAAATCCAATTGTCTAAA
TCGAGTACAAGTTCGATGTTCCATGGCTAAATTGCTACCCAAAGAAAAGA
AAAGAAACTTCATTCATCAATGGAAGAATTGCACGACACGGTGTGCTTAT
TCAAGGTGATCATGTGGTCTAATTGACATGAACATAGCAGCATATCTCAT
AAGTCTGTTGCTCTCATTGCCTTCTCCATTTTCAGTTACAGAAATCACAG
GACCTCTAGTCCTCATCCTGTATCTTCTCCAAGCAAATTGAATATTCACA
GCCGCCCATGTCCTCCAATTTGATGAATAATATCTCGCGGTTCTCTTCAG
CCTTTCGTTGGCAAATTTGTACCGGAAATGATCTGTGATGTATCGGAGAT
TCTTTGCATCTAACCCAAATGCTTCTATGGATTCCATACAAAAAAATGTT
GCTGATGATGCTGGCAGCCGATCGATAAACGGGCGGCGCAGGACCAGGAA
AGAANNNATC
back to top